Comparing CA265_RS02025 FitnessBrowser__Pedo557:CA265_RS02025 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7u7hA Cysteate acyl-acp transferase from alistipes finegoldii (see paper)
68% identity, 99% coverage: 1:407/413 of query aligns to 2:409/423 of 7u7hA
7v58B Structural insights into the substrate selectivity of acyl-coa transferase (see paper)
34% identity, 87% coverage: 42:401/413 of query aligns to 43:397/400 of 7v58B
8h29A Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-threonine (see paper)
31% identity, 92% coverage: 24:401/413 of query aligns to 24:393/394 of 8h29A
8h21A Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-alanine (see paper)
31% identity, 92% coverage: 24:401/413 of query aligns to 24:393/394 of 8h21A
8h20A Serine palmitoyltransferase from sphingobacterium multivorum complexed with glycine (see paper)
31% identity, 92% coverage: 24:401/413 of query aligns to 24:393/394 of 8h20A
8h1yA Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-homoserine (see paper)
31% identity, 92% coverage: 24:401/413 of query aligns to 24:393/394 of 8h1yA
8h1qA Serine palmitoyltransferase from sphingobacterium multivorum complexed with l-serine (see paper)
31% identity, 92% coverage: 24:401/413 of query aligns to 24:393/394 of 8h1qA
8guhA Serine palmitoyltransferase from sphingobacterium multivorum complexed with tris (see paper)
31% identity, 92% coverage: 24:401/413 of query aligns to 24:393/394 of 8guhA
1fc4A 2-amino-3-ketobutyrate coa ligase (see paper)
34% identity, 87% coverage: 42:400/413 of query aligns to 44:397/401 of 1fc4A
P0AB77 2-amino-3-ketobutyrate coenzyme A ligase; AKB ligase; Glycine acetyltransferase; EC 2.3.1.29 from Escherichia coli (strain K12) (see paper)
34% identity, 87% coverage: 42:400/413 of query aligns to 41:394/398 of P0AB77
3a2bA Crystal structure of serine palmitoyltransferase from sphingobacterium multivorum with substrate l-serine (see paper)
32% identity, 90% coverage: 24:396/413 of query aligns to 24:388/392 of 3a2bA
Q5W264 4-hydroxy-2,2'-bipyrrole-5-methanol synthase PigH; HBM synthase; Aminotransferase PigH; EC 2.3.2.- from Serratia sp. (strain ATCC 39006) (see paper)
33% identity, 87% coverage: 43:403/413 of query aligns to 285:635/653 of Q5W264
Sites not aligning to the query:
3tqxA Structure of the 2-amino-3-ketobutyrate coenzyme a ligase (kbl) from coxiella burnetii (see paper)
33% identity, 87% coverage: 43:400/413 of query aligns to 40:393/396 of 3tqxA
7poaA An irreversible, promiscuous and highly thermostable claisen- condensation biocatalyst drives the synthesis of substituted pyrroles
33% identity, 91% coverage: 24:400/413 of query aligns to 25:394/398 of 7poaA
Q93UV0 Serine palmitoyltransferase; SPT; EC 2.3.1.50 from Sphingomonas paucimobilis (Pseudomonas paucimobilis) (see 4 papers)
33% identity, 86% coverage: 40:393/413 of query aligns to 62:409/420 of Q93UV0
Sites not aligning to the query:
2xbnA Inhibition of the plp-dependent enzyme serine palmitoyltransferase by cycloserine: evidence for a novel decarboxylative mechanism of inactivation (see paper)
33% identity, 86% coverage: 40:393/413 of query aligns to 41:388/398 of 2xbnA
2w8jA Spt with plp-ser (see paper)
33% identity, 86% coverage: 40:393/413 of query aligns to 41:388/398 of 2w8jA
Sites not aligning to the query:
7bxsA 2-amino-3-ketobutyrate coa ligase from cupriavidus necator glycine binding form
31% identity, 87% coverage: 42:400/413 of query aligns to 43:396/399 of 7bxsA
7bxrA 2-amino-3-ketobutyrate coa ligase from cupriavidus necator 3- hydroxynorvaline binding form
31% identity, 87% coverage: 42:400/413 of query aligns to 43:396/399 of 7bxrA
7bxqA 2-amino-3-ketobutyrate coa ligase from cupriavidus necator l-threonine binding form
31% identity, 87% coverage: 42:400/413 of query aligns to 43:396/399 of 7bxqA
>CA265_RS02025 FitnessBrowser__Pedo557:CA265_RS02025
MDIFDKIAKHMGPLGQHQKWSHGYFSFPKLEGEIAPHMQFRGKEHLVWSLNNYLGLANHP
EVRKADEEAAAKFGMAYPMGARMMSGNSNYHEQLEQELAEFVGKPDAFLLNYGYQGMVSI
IDTLVDRNDVVVYDAESHACIVDGLRLHMGKRFVYKHNDIESARKQLERATKLVEETGGG
ILLITEGVFGMSGAQGKLKEIVDLKKDFNFRILVDDAHGFGTMGKTGAGTHEAQDCIEGI
DVYFGTFAKSMAGIGAFVASTEQITNFLRYNMRSQTFAKALPMPMVIGLLKRLELLKSKP
ELKDKLWEIAMTLQKGLRERGFDLGVTDSVVTPVFLKGELSDATAITYDLRENYSIFCSI
VVYPVIPKGMIELRLIPTAVHTLEDVQRTLDAFSEVAEKLENGYYKENLFATV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory