Comparing CA265_RS02050 FitnessBrowser__Pedo557:CA265_RS02050 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1o5kA Crystal structure of dihydrodipicolinate synthase (tm1521) from thermotoga maritima at 1.80 a resolution
40% identity, 95% coverage: 4:284/295 of query aligns to 3:282/295 of 1o5kA
Q9X1K9 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
40% identity, 95% coverage: 4:284/295 of query aligns to 2:281/294 of Q9X1K9
5t25A Kinetic, spectral and structural characterization of the slow binding inhibitor acetopyruvate with dihydrodipicolinate synthase from escherichia coli.
41% identity, 97% coverage: 4:289/295 of query aligns to 3:288/293 of 5t25A
2atsA Dihydrodipicolinate synthase co-crystallised with (s)-lysine
41% identity, 97% coverage: 4:289/295 of query aligns to 2:287/292 of 2atsA
P0A6L2 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Escherichia coli (strain K12) (see 7 papers)
41% identity, 97% coverage: 4:289/295 of query aligns to 2:287/292 of P0A6L2
5ktlA Dihydrodipicolinate synthase from the industrial and evolutionarily important cyanobacteria anabaena variabilis. (see paper)
40% identity, 96% coverage: 10:292/295 of query aligns to 11:293/295 of 5ktlA
3i7sA Dihydrodipicolinate synthase mutant - k161a - with the substrate pyruvate bound in the active site. (see paper)
40% identity, 97% coverage: 4:289/295 of query aligns to 2:287/292 of 3i7sA
4dxvA Crystal structure of dihydrodipicolinate synthase from acinetobacter baumannii complexed with mg and cl ions at 1.80 a resolution
39% identity, 92% coverage: 4:273/295 of query aligns to 2:270/291 of 4dxvA
3u8gA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with oxalic acid at 1.80 a resolution
39% identity, 92% coverage: 4:273/295 of query aligns to 2:270/291 of 3u8gA
3tdfA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 2-ketobutanoic acid at 1.99 a resolution
39% identity, 92% coverage: 4:273/295 of query aligns to 2:270/291 of 3tdfA
3tceA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 5-hydroxylysine at 2.6 a resolution
39% identity, 92% coverage: 4:273/295 of query aligns to 2:270/291 of 3tceA
3rk8A Crystal structure of the chloride inhibited dihydrodipicolinate synthase from acinetobacter baumannii complexed with pyruvate at 1.8 a resolution
39% identity, 92% coverage: 4:273/295 of query aligns to 2:270/291 of 3rk8A
3pueB Crystal structure of the complex of dhydrodipicolinate synthase from acinetobacter baumannii with lysine at 2.6a resolution
39% identity, 92% coverage: 4:273/295 of query aligns to 2:270/291 of 3pueB
Q07607 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; Protein MosA; EC 4.3.3.7 from Rhizobium meliloti (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
40% identity, 95% coverage: 4:284/295 of query aligns to 2:281/292 of Q07607
4pfmA Shewanella benthica dhdps with lysine and pyruvate
39% identity, 94% coverage: 4:281/295 of query aligns to 3:280/295 of 4pfmA
3s8hA Structure of dihydrodipicolinate synthase complexed with 3- hydroxypropanoic acid(hpa)at 2.70 a resolution
39% identity, 92% coverage: 6:277/295 of query aligns to 4:274/292 of 3s8hA
3puoA Crystal structure of dihydrodipicolinate synthase from pseudomonas aeruginosa(psdhdps)complexed with l-lysine at 2.65a resolution (see paper)
39% identity, 92% coverage: 6:277/295 of query aligns to 4:274/292 of 3puoA
5ud6C Crystal structure of dhdps from cyanidioschyzon merolae with lysine bound
39% identity, 93% coverage: 10:284/295 of query aligns to 10:288/299 of 5ud6C
4fhaA Structure of dihydrodipicolinate synthase from streptococcus pneumoniae,bound to pyruvate and lysine
38% identity, 94% coverage: 10:285/295 of query aligns to 13:287/307 of 4fhaA
4i7wA Agrobacterium tumefaciens dhdps with lysine and pyruvate
37% identity, 97% coverage: 4:289/295 of query aligns to 2:284/294 of 4i7wA
>CA265_RS02050 FitnessBrowser__Pedo557:CA265_RS02050
MNKFQGTGVALVTPFNTDGSVDYNGLKNLINHLVDGGIDYLVSLGTTGETATMTKDEKKK
VWAYTAEINNNRLPLVAGIGGNNTLAVAEDIKSLDAAGYSAILSVSPYYNKPTQEGIYQH
YKYLAEISPLDLILYNVPGRTGSNMSPETTCRLAHDFKNIIATKEASGSFDQFNQIMRDK
PADFLLISGDDPVTLPMIALGAAGIISVIGNALPKQFSDMVKLCLAGDYKAALPAHLGLI
EFTRLAFAEGNPAGIKAALKHLGVCGDTVRLPLVKASASLEKSIIAEIEKLSEVA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory