Comparing CA265_RS02090 FitnessBrowser__Pedo557:CA265_RS02090 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
40% identity, 98% coverage: 1:204/208 of query aligns to 4:212/650 of 5ws4A
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
45% identity, 80% coverage: 32:198/208 of query aligns to 39:206/648 of P75831
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
35% identity, 88% coverage: 22:204/208 of query aligns to 30:214/233 of P75957
7mdyC Lolcde nucleotide-bound
35% identity, 88% coverage: 22:204/208 of query aligns to 27:211/226 of 7mdyC
Sites not aligning to the query:
7arlD Lolcde in complex with lipoprotein and adp (see paper)
35% identity, 88% coverage: 22:204/208 of query aligns to 27:211/222 of 7arlD
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
36% identity, 97% coverage: 1:201/208 of query aligns to 1:211/232 of 1f3oA
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
35% identity, 88% coverage: 22:204/208 of query aligns to 29:213/229 of 7v8iD
Sites not aligning to the query:
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
36% identity, 97% coverage: 1:201/208 of query aligns to 1:211/230 of 1l2tA
P0A9R7 Cell division ATP-binding protein FtsE from Escherichia coli (strain K12) (see paper)
38% identity, 94% coverage: 1:195/208 of query aligns to 1:196/222 of P0A9R7
8w6iD Cryo-em structure of escherichia coli str k12 ftsex complex with atp- gamma-s in peptidisc
38% identity, 94% coverage: 1:195/208 of query aligns to 1:196/219 of 8w6iD
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
36% identity, 92% coverage: 17:208/208 of query aligns to 23:215/226 of 5xu1B
8hd0A Cell divisome spg hydrolysis machinery ftsex-envc
37% identity, 94% coverage: 1:195/208 of query aligns to 1:196/218 of 8hd0A
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
40% identity, 80% coverage: 32:198/208 of query aligns to 38:205/592 of 5lj7A
Sites not aligning to the query:
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
40% identity, 80% coverage: 32:198/208 of query aligns to 38:205/615 of 5lilA
Sites not aligning to the query:
8g4cB Bceabs atpgs high res tm (see paper)
34% identity, 85% coverage: 32:208/208 of query aligns to 38:216/248 of 8g4cB
Sites not aligning to the query:
7tchB Bceab e169q variant atp-bound conformation (see paper)
34% identity, 85% coverage: 32:208/208 of query aligns to 37:215/245 of 7tchB
Sites not aligning to the query:
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
38% identity, 84% coverage: 32:205/208 of query aligns to 34:208/223 of 2pclA
7w78A Heme exporter hrtba in complex with mg-amppnp (see paper)
40% identity, 86% coverage: 23:201/208 of query aligns to 30:203/218 of 7w78A
Sites not aligning to the query:
7w79A Heme exporter hrtba in complex with mn-amppnp (see paper)
40% identity, 86% coverage: 23:201/208 of query aligns to 30:203/216 of 7w79A
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
35% identity, 98% coverage: 1:203/208 of query aligns to 1:208/343 of P30750
Sites not aligning to the query:
>CA265_RS02090 FitnessBrowser__Pedo557:CA265_RS02090
MIKISALAHVYEKGRRLKFPYWEIADMEQWLLLGASGSGKSTLLNIISGLLEPTQGEVLV
NGTDLYTLPARGRDRFRGRHIGIIFQRPHLIRSLDVLDNLELAAVMAGVPVDHERNLSLL
HELGIAGLAKNYPDQLSEGQLQRVSVARALVNKPDLLIADEPTSSLDDENASLVIQMLTT
QAKDNGAALIIATHDRRVQEYITKTYLL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory