SitesBLAST
Comparing CA265_RS02195 FitnessBrowser__Pedo557:CA265_RS02195 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6pfkA Phosphofructokinase, inhibited t-state (see paper)
52% identity, 99% coverage: 5:328/328 of query aligns to 1:319/319 of 6pfkA
- active site: G11 (= G15), R72 (= R76), C73 (= C77), D103 (= D107), G104 (= G108), G124 (= G129), T125 (= T130), D127 (= D132), D129 (= D134), R171 (= R176)
- binding 2-phosphoglycolic acid: R21 (= R25), R25 (= R29), G58 (≠ S62), D59 (≠ N63), R154 (= R159), R211 (≠ T216), K213 (= K218)
P00512 ATP-dependent 6-phosphofructokinase; ATP-PFK; Phosphofructokinase; Phosphohexokinase; EC 2.7.1.11 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see 2 papers)
52% identity, 99% coverage: 5:328/328 of query aligns to 1:319/319 of P00512
- RSVVR 21:25 (≠ RAVVR 25:29) binding
- D59 (≠ N63) binding
- RC 72:73 (= RC 76:77) binding
- D103 (= D107) binding
- TID 125:127 (= TID 130:132) binding in other chain
- R154 (= R159) binding in other chain
- R162 (= R167) binding
- MGR 169:171 (= MGR 174:176) binding in other chain
- GAE 185:187 (= GAE 190:192) binding in other chain
- R211 (≠ T216) binding in other chain
- KKH 213:215 (≠ KSS 218:220) binding in other chain
- E222 (= E227) binding in other chain
- R243 (≠ K251) binding
- HVQR 249:252 (≠ HLQR 257:260) binding in other chain
1mtoA Crystal structure of a phosphofructokinase mutant from bacillus stearothermophilus bound with fructose-6-phosphate (see paper)
52% identity, 99% coverage: 5:328/328 of query aligns to 1:319/319 of 1mtoA
- active site: G11 (= G15), R72 (= R76), C73 (= C77), D103 (= D107), G104 (= G108), G124 (= G129), T125 (= T130), D127 (= D132), D129 (= D134), R171 (= R176)
- binding 6-O-phosphono-beta-D-fructofuranose: D127 (= D132), R162 (= R167), M169 (= M174), R171 (= R176), E222 (= E227), R243 (≠ K251), H249 (= H257), R252 (= R260)
4pfkA Phosphofructokinase. Structure and control (see paper)
52% identity, 99% coverage: 5:328/328 of query aligns to 1:319/319 of 4pfkA
- active site: G11 (= G15), R72 (= R76), C73 (= C77), D103 (= D107), G104 (= G108), G124 (= G129), T125 (= T130), D127 (= D132), D129 (= D134), R171 (= R176)
- binding adenosine-5'-diphosphate: S9 (= S13), Y41 (= Y45), R72 (= R76), C73 (= C77), F76 (= F80), K77 (= K81), G104 (= G108), G108 (= G112), R154 (= R159), G185 (= G190), R211 (≠ T216), G212 (≠ K217), K213 (= K218), H215 (≠ S220)
- binding 6-O-phosphono-beta-D-fructofuranose: D127 (= D132), M169 (= M174), E222 (= E227), H249 (= H257), R252 (= R260)
- binding magnesium ion: G185 (= G190), E187 (= E192)
3pfkA Phosphofructokinase. Structure and control (see paper)
52% identity, 99% coverage: 5:328/328 of query aligns to 1:319/319 of 3pfkA
- active site: G11 (= G15), R72 (= R76), C73 (= C77), D103 (= D107), G104 (= G108), G124 (= G129), T125 (= T130), D127 (= D132), D129 (= D134), R171 (= R176)
- binding phosphate ion: R154 (= R159), K213 (= K218), H249 (= H257), R252 (= R260)
4i4iA Crystal structure of bacillus stearothermophilus phosphofructokinase mutant t156a bound to pep (see paper)
52% identity, 99% coverage: 5:328/328 of query aligns to 1:319/319 of 4i4iA
- active site: G11 (= G15), R72 (= R76), C73 (= C77), D103 (= D107), G104 (= G108), G124 (= G129), T125 (= T130), D127 (= D132), D129 (= D134), R171 (= R176)
- binding phosphoenolpyruvate: R21 (= R25), R25 (= R29), G58 (≠ S62), R154 (= R159), R211 (≠ T216), K213 (= K218), H215 (≠ S220)
5xzaA Crystal structure of phosphofructokinase from staphylococcus aureus in complex with adp (see paper)
51% identity, 99% coverage: 5:328/328 of query aligns to 1:322/322 of 5xzaA
Q2FXM8 ATP-dependent 6-phosphofructokinase; ATP-PFK; Phosphofructokinase; Phosphohexokinase; EC 2.7.1.11 from Staphylococcus aureus (strain NCTC 8325 / PS 47) (see paper)
51% identity, 99% coverage: 5:328/328 of query aligns to 1:322/322 of Q2FXM8
- RC 72:73 (= RC 76:77) binding
- GDGS 102:105 (≠ GDGT 106:109) binding
- TID 127:129 (= TID 130:132) binding in other chain
- G150 (≠ E153) mutation to D: Exhibits higher affinity for fructose 6-phosphate and higher catalytic activity with a loss of dimer conversion; in association with A-151.
- L151 (≠ A154) mutation to A: Exhibits higher affinity for fructose 6-phosphate and higher catalytic activity with a loss of tetramer-dimer conversion; in association with D-150.
- R164 (= R167) mutation to A: Complete loss of fructose 6-phosphate binding.
- MGR 171:173 (= MGR 174:176) binding in other chain
- E224 (= E227) binding in other chain
- R245 (≠ K251) mutation to A: Complete loss of fructose 6-phosphate binding.
- HVQR 251:254 (≠ HLQR 257:260) binding in other chain
5xz9A Crystal structure of phosphofructokinase from staphylococcus aureus in complex with adenylylimidodiphosphate, the atp analogue (see paper)
51% identity, 98% coverage: 5:327/328 of query aligns to 1:321/321 of 5xz9A
- binding adenosine-5'-triphosphate: S9 (= S13), Y41 (= Y45), C73 (= C77), F76 (= F80), K77 (= K81), G102 (= G106), D103 (= D107), G104 (= G108), S105 (≠ T109), R107 (≠ T111), G108 (= G112)
5xz6A Crystal structure of phosphofructokinase from staphylococcus aureus in complex with adenylylimidodiphosphate, the atp analogue (see paper)
51% identity, 99% coverage: 5:328/328 of query aligns to 1:318/318 of 5xz6A
5xz7A Crystal structure of phosphofructokinase from staphylococcus aureus in complex with adenylylimidodiphosphate, the atp analogue (see paper)
51% identity, 99% coverage: 5:328/328 of query aligns to 1:318/322 of 5xz7A
1pfkA Crystal structure of the complex of phosphofructokinase from escherichia coli with its reaction products (see paper)
44% identity, 98% coverage: 5:326/328 of query aligns to 2:319/320 of 1pfkA
- active site: G12 (= G15), R73 (= R76), F74 (≠ C77), D104 (= D107), G105 (= G108), G125 (= G129), T126 (= T130), D128 (= D132), D130 (= D134), R172 (= R176)
- binding adenosine-5'-diphosphate: G11 (= G14), R22 (= R25), R26 (= R29), Y56 (≠ R59), S59 (= S62), D60 (≠ N63), R73 (= R76), F74 (≠ C77), F77 (= F80), R78 (≠ K81), G103 (= G106), D104 (= D107), G105 (= G108), S106 (≠ T109), M108 (≠ T111), G109 (= G112), R155 (= R159), G213 (≠ K217), K214 (= K218), H216 (≠ S220)
- binding 1,6-di-O-phosphono-beta-D-fructofuranose: G12 (= G15), R73 (= R76), T126 (= T130), D128 (= D132), M170 (= M174), E223 (= E227), H250 (= H257), R253 (= R260)
- binding magnesium ion: G186 (= G190), E188 (= E192)
P0A796 ATP-dependent 6-phosphofructokinase isozyme 1; ATP-PFK 1; Phosphofructokinase 1; 6-phosphofructokinase isozyme I; Phosphohexokinase 1; Sedoheptulose-7-phosphate kinase; EC 2.7.1.11 from Escherichia coli (strain K12) (see 2 papers)
44% identity, 98% coverage: 5:326/328 of query aligns to 2:319/320 of P0A796
- G12 (= G15) binding
- RGVVR 22:26 (≠ RAVVR 25:29) binding
- RYSVSD 55:60 (≠ ARSVSN 58:63) binding
- RF 73:74 (≠ RC 76:77) binding
- GDGS 103:106 (≠ GDGT 106:109) binding
- D104 (= D107) binding
- TID 126:128 (= TID 130:132) binding in other chain
- D128 (= D132) active site, Proton acceptor; mutation to S: 18000-fold reduction of catalytic rate.
- R155 (= R159) binding in other chain
- R163 (= R167) binding
- R172 (= R176) mutation to S: 3.4-fold reduction in turnover numbers.
- GCE 186:188 (≠ GAE 190:192) binding in other chain
- KKH 214:216 (≠ KSS 218:220) binding in other chain
- E223 (= E227) binding in other chain
- R244 (≠ K251) binding
- HIQR 250:253 (≠ HLQR 257:260) binding in other chain
4xyjA Crystal structure of human phosphofructokinase-1 in complex with atp and mg, northeast structural genomics consortium target hr9275 (see paper)
46% identity, 89% coverage: 6:297/328 of query aligns to 13:338/768 of 4xyjA
- active site: G22 (= G15), R85 (= R76), C86 (= C77), D116 (= D107), G160 (= G129), S161 (≠ T130), D163 (= D132), D165 (= D134), R207 (= R176)
- binding adenosine-5'-triphosphate: G21 (= G14), G22 (= G15), Y52 (= Y45), C86 (= C77), F89 (= F80), R90 (≠ K81), G115 (= G106), D116 (= D107), G117 (= G108), S118 (≠ T109), G121 (= G112), S161 (≠ T130), R207 (= R176)
- binding magnesium ion: G21 (= G14), G22 (= G15), D116 (= D107), D165 (= D134)
- binding phosphate ion: R32 (= R25), R36 (= R29), S72 (≠ N63), G221 (= G190), K252 (= K218)
Sites not aligning to the query:
4xykA Crystal structure of human phosphofructokinase-1 in complex with adp, northeast structural genomics consortium target hr9275 (see paper)
46% identity, 89% coverage: 6:297/328 of query aligns to 9:334/737 of 4xykA
- active site: G18 (= G15), R81 (= R76), C82 (= C77), D112 (= D107), G156 (= G129), S157 (≠ T130), D159 (= D132), D161 (= D134), R203 (= R176)
- binding adenosine-5'-diphosphate: Y48 (= Y45), R81 (= R76), C82 (= C77), R86 (≠ K81), G111 (= G106), D112 (= D107), G113 (= G108), S114 (≠ T109)
- binding phosphate ion: R28 (= R25), R32 (= R29), S67 (= S62), K248 (= K218)
Sites not aligning to the query:
Q01813 ATP-dependent 6-phosphofructokinase, platelet type; ATP-PFK; PFK-P; 6-phosphofructokinase type C; Phosphofructo-1-kinase isozyme C; PFK-C; Phosphohexokinase; EC 2.7.1.11 from Homo sapiens (Human) (see paper)
46% identity, 89% coverage: 6:297/328 of query aligns to 25:350/784 of Q01813
Sites not aligning to the query:
- 386 modified: Phosphoserine; S→A: Decreased interaction with ATG4B.
4xyjF Crystal structure of human phosphofructokinase-1 in complex with atp and mg, northeast structural genomics consortium target hr9275 (see paper)
46% identity, 89% coverage: 6:297/328 of query aligns to 11:336/761 of 4xyjF
- active site: G20 (= G15), R83 (= R76), C84 (= C77), D114 (= D107), G158 (= G129), S159 (≠ T130), D161 (= D132), D163 (= D134), R205 (= R176)
- binding adenosine-5'-triphosphate: G20 (= G15), Y50 (= Y45), R83 (= R76), C84 (= C77), F87 (= F80), R88 (≠ K81), G113 (= G106), D114 (= D107), G115 (= G108), S116 (≠ T109), G119 (= G112), S159 (≠ T130)
- binding magnesium ion: G19 (= G14), G20 (= G15), G112 (= G105), D114 (= D107), G158 (= G129), D163 (= D134), R205 (= R176)
- binding phosphate ion: R30 (= R25), R34 (= R29), S69 (= S62), S70 (≠ N63), G219 (= G190), K250 (= K218)
Sites not aligning to the query:
4rh3A Amppcp-bound structure of human platelet phosphofructokinase in an r- state, crystal form ii (see paper)
46% identity, 88% coverage: 8:297/328 of query aligns to 3:326/731 of 4rh3A
- active site: G10 (= G15), R73 (= R76), C74 (= C77), D104 (= D107), G148 (= G129), S149 (≠ T130), D151 (= D132), D153 (= D134), R195 (= R176)
- binding phosphomethylphosphonic acid adenylate ester: G9 (= G14), R73 (= R76), C74 (= C77), F77 (= F80), R78 (≠ K81), G103 (= G106), D104 (= D107), G105 (= G108), S106 (≠ T109), G109 (= G112)
- binding phosphate ion: K240 (= K218)
Sites not aligning to the query:
P08237 ATP-dependent 6-phosphofructokinase, muscle type; ATP-PFK; PFK-M; 6-phosphofructokinase type A; Phosphofructo-1-kinase isozyme A; PFK-A; Phosphohexokinase; EC 2.7.1.11 from Homo sapiens (Human) (see 6 papers)
44% identity, 89% coverage: 6:298/328 of query aligns to 16:342/780 of P08237
- R39 (= R29) to P: in GSD7; Italian; dbSNP:rs121918193
- G57 (= G47) to V: in GSD7; Italian
- R100 (≠ I88) to Q: in dbSNP:rs2228500
- S180 (≠ T146) to C: in GSD7; Italian
- G209 (= G175) to D: in GSD7; loss of activity shown by complementation assays in yeast; dbSNP:rs767265360
- D309 (= D268) to G: in GSD7; Spanish; complete loss of enzyme activity; dbSNP:rs1169383137
Sites not aligning to the query:
- 543 D → A: in GSD7; Italian; dbSNP:rs121918194
- 557 modified: N6-(2-hydroxyisobutyryl)lysine
- 591 D → A: in GSD7; Italian
- 686 W → C: in GSD7; Japanese; dbSNP:rs121918196
- 696 R → H: in dbSNP:rs41291971
3o8lA Structure of phosphofructokinase from rabbit skeletal muscle (see paper)
43% identity, 89% coverage: 6:298/328 of query aligns to 8:334/748 of 3o8lA
- active site: G17 (= G15), R80 (= R76), D111 (= D107), S156 (≠ T130), D158 (= D132), D160 (= D134), R202 (= R176)
- binding adenosine-5'-diphosphate: D165 (= D139), M166 (≠ F140), F300 (= F267)
- binding adenosine-5'-triphosphate: G16 (= G14), Y47 (= Y45), R80 (= R76), C81 (= C77), R85 (≠ K81), G110 (= G106), G112 (= G108), S113 (≠ T109), T115 (= T111), G116 (= G112), W219 (≠ A193), H234 (≠ E205), R238 (≠ K209)
Sites not aligning to the query:
Query Sequence
>CA265_RS02195 FitnessBrowser__Pedo557:CA265_RS02195
MEPNIKNIAVLTSGGDAPGMNAAIRAVVRTGIYHGINMFGVMQGYQGLITDNIKPMDARS
VSNILHLGGTILKTARCLEFKTDEGQQIAYNNLKKNGIDGLVVIGGDGTFTGAKRFSETF
GVKVIGIPGTIDNDLVGSDFTLGYDTAINTVIEAIDKIRDTADAHDRLFFIEVMGRDSGC
IALRSSIASGAEAVLLPEKETSVTELIEKLALGAATKKSSSIVIVAEGHKQGGAYDIAKK
VKETFDHYDTKVTILGHLQRGGSPSSFDRILGSRLGFAAVNALIAGETEQMVGLKGNEIK
LTSIREALTAHSFKLEPDLMEMTEVLSI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory