SitesBLAST
Comparing CA265_RS02630 FitnessBrowser__Pedo557:CA265_RS02630 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8cxaA Crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from mycobacterium smegmatis with bound NAD
36% identity, 28% coverage: 442:640/706 of query aligns to 3:204/251 of 8cxaA
- binding nicotinamide-adenine-dinucleotide: G12 (= G451), Q15 (≠ G454), G16 (= G455), I17 (= I456), D36 (= D475), V63 (= V504), N89 (= N530), A91 (≠ G532), S94 (≠ I535), I142 (= I581), S143 (≠ V582), S144 (= S583), Y157 (= Y596), K161 (= K600), P187 (= P626), H188 (≠ D627), I190 (≠ V629), I194 (vs. gap)
7ejhA Crystal structure of kred mutant-f147l/l153q/y190p/l199a/m205f/m206f and 2-hydroxyisoindoline-1,3-dione complex
32% identity, 37% coverage: 442:699/706 of query aligns to 6:249/253 of 7ejhA
- binding 2-oxidanylisoindole-1,3-dione: S144 (= S583), I145 (≠ K584), E146 (≠ N585), Y157 (= Y596), V197 (≠ I630), F207 (≠ Y659)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G451), T17 (≠ A453), I20 (= I456), R40 (≠ M476), H41 (≠ N477), D64 (≠ N503), A65 (≠ V504), N91 (= N530), A92 (= A531), V114 (= V553), M142 (≠ I581), S144 (= S583), Y157 (= Y596), K161 (= K600), P189 (= P626), G190 (≠ D627), P191 (≠ A628), I192 (≠ V629), T194 (vs. gap), P195 (vs. gap), L196 (vs. gap)
6zzsD Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and 3-oxovalerate (see paper)
40% identity, 26% coverage: 440:626/706 of query aligns to 3:186/261 of 6zzsD
- active site: G18 (= G455), S143 (= S583), Y156 (= Y596)
- binding nicotinamide-adenine-dinucleotide: G14 (= G451), S17 (≠ G454), I19 (= I456), D38 (= D475), M39 (= M476), D64 (≠ N503), V65 (= V504), N91 (= N530), A92 (= A531), G93 (= G532), M141 (≠ I581), A142 (≠ V582), S143 (= S583), Y156 (= Y596), K160 (= K600), P186 (= P626)
- binding 3-oxidanylidenepentanoic acid: Q95 (≠ S534), S143 (= S583), N145 (= N585), K153 (≠ N593), Y156 (= Y596)
Sites not aligning to the query:
7ejiB Crystal structure of kred f147l/l153q/y190p/l199a/m205f/m206f variant and methyl methacrylate complex
32% identity, 37% coverage: 442:699/706 of query aligns to 4:247/251 of 7ejiB
- binding methyl 2-methylprop-2-enoate: S142 (= S583), I143 (≠ K584), Y155 (= Y596), F205 (≠ Y659)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G451), T15 (≠ A453), L16 (≠ G454), G17 (= G455), I18 (= I456), R38 (≠ M476), H39 (≠ N477), D62 (≠ N503), A63 (≠ V504), N89 (= N530), A90 (= A531), V112 (= V553), M140 (≠ I581), S142 (= S583), Y155 (= Y596), K159 (= K600), P187 (= P626), P189 (≠ A628), I190 (≠ V629), T192 (≠ S631), P193 (≠ D632), L194 (≠ S633)
6zzqA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and acetoacetate (see paper)
40% identity, 26% coverage: 440:626/706 of query aligns to 2:185/260 of 6zzqA
- active site: G17 (= G455), S142 (= S583), Y155 (= Y596)
- binding acetoacetic acid: Q94 (≠ S534), S142 (= S583), K152 (≠ N593), Y155 (= Y596)
- binding nicotinamide-adenine-dinucleotide: G13 (= G451), S16 (≠ G454), G17 (= G455), I18 (= I456), D37 (= D475), M38 (= M476), D63 (≠ N503), V64 (= V504), N90 (= N530), A91 (= A531), G92 (= G532), M140 (≠ I581), A141 (≠ V582), S142 (= S583), Y155 (= Y596), K159 (= K600)
Sites not aligning to the query:
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
33% identity, 37% coverage: 445:702/706 of query aligns to 6:245/248 of Q9KJF1
- S15 (≠ G454) binding
- D36 (= D475) binding
- D62 (≠ V501) binding
- I63 (≠ L502) binding
- N89 (= N530) binding
- Y153 (= Y596) binding
- K157 (= K600) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
33% identity, 37% coverage: 445:702/706 of query aligns to 5:244/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G451), M16 (≠ I456), D35 (= D475), I36 (≠ M476), I62 (≠ L502), N88 (= N530), G90 (= G532), I138 (= I581), S140 (= S583), Y152 (= Y596), K156 (= K600), I185 (≠ V629)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
32% identity, 37% coverage: 442:702/706 of query aligns to 3:247/247 of 4jroC
- active site: G16 (= G455), S142 (= S583), Q152 (≠ N593), Y155 (= Y596), K159 (= K600)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G451), S14 (≠ A453), R15 (≠ G454), G16 (= G455), I17 (= I456), N35 (= N474), Y36 (≠ D475), N37 (≠ M476), G38 (≠ N477), S39 (≠ A478), N63 (= N503), V64 (= V504), N90 (= N530), A91 (= A531), I93 (≠ L533), I113 (≠ V553), S142 (= S583), Y155 (= Y596), K159 (= K600), P185 (= P626), I188 (≠ V629), T190 (≠ S631)
7wbcA Hydroxysteroid dehydrogenase wild-type complexed with NAD+ and (4s)-2- 2-methyl-2,4-pentanediol
35% identity, 28% coverage: 442:636/706 of query aligns to 3:193/250 of 7wbcA
- binding calcium ion: Y115 (≠ K556), P116 (≠ G557), H119 (≠ F560)
- binding nicotinamide-adenine-dinucleotide: G12 (= G451), G16 (= G455), I17 (= I456), D36 (= D475), V37 (≠ M476), A61 (= A500), D62 (≠ N503), I63 (≠ V504), N89 (= N530), F138 (≠ I581), S140 (= S583), Y153 (= Y596), K157 (= K600), P183 (= P626), F184 (≠ D627), A185 (= A628), T187 (≠ I630), G189 (≠ D632), V190 (≠ S633)
Q6WVP7 NADP-dependent (R)-specific alcohol dehydrogenase; (R)-specific ADH; Ketoreductase; KRED; EC 1.1.1.- from Lentilactobacillus kefiri (Lactobacillus kefiri) (see paper)
32% identity, 37% coverage: 442:699/706 of query aligns to 5:248/252 of Q6WVP7
Sites not aligning to the query:
3ai3C The crystal structure of l-sorbose reductase from gluconobacter frateurii complexed with NADPH and l-sorbose (see paper)
31% identity, 37% coverage: 442:700/706 of query aligns to 5:259/263 of 3ai3C
- active site: G18 (= G455), S144 (= S583), Y157 (= Y596), K161 (= K600)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G14 (= G451), S16 (≠ A453), S17 (≠ G454), G18 (= G455), I19 (= I456), A38 (≠ D475), R39 (≠ M476), Q40 (≠ N477), R43 (= R480), D65 (≠ N503), V66 (= V504), N92 (= N530), G94 (= G532), N142 (≠ I581), Y157 (= Y596), K161 (= K600), P187 (= P626), G188 (≠ D627), I190 (≠ V629), T192 (≠ S631), W195 (= W636)
- binding alpha-L-sorbopyranose: A252 (≠ V693), F254 (≠ N695)
- binding L-sorbose: G96 (≠ S534), E154 (≠ N593), Y157 (= Y596), W195 (= W636)
Sites not aligning to the query:
3ai3A The crystal structure of l-sorbose reductase from gluconobacter frateurii complexed with NADPH and l-sorbose (see paper)
31% identity, 37% coverage: 442:700/706 of query aligns to 5:259/263 of 3ai3A
- active site: G18 (= G455), S144 (= S583), Y157 (= Y596), K161 (= K600)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G14 (= G451), S16 (≠ A453), S17 (≠ G454), G18 (= G455), I19 (= I456), A38 (≠ D475), R39 (≠ M476), Q40 (≠ N477), R43 (= R480), V64 (= V501), D65 (≠ N503), V66 (= V504), N92 (= N530), G94 (= G532), N142 (≠ I581), S144 (= S583), Y157 (= Y596), K161 (= K600), P187 (= P626), G188 (≠ D627), I190 (≠ V629), T192 (≠ S631), W195 (= W636)
- binding L-sorbose: G96 (≠ S534), S144 (= S583), L151 (≠ G590), E154 (≠ N593), Y157 (= Y596), G188 (≠ D627)
7krmC Putative fabg bound to nadh from acinetobacter baumannii
32% identity, 37% coverage: 442:700/706 of query aligns to 3:241/244 of 7krmC
- active site: G18 (= G455), S140 (= S583), Y155 (= Y596)
- binding nicotinamide-adenine-dinucleotide: G12 (= G451), S15 (≠ G454), G18 (= G455), I19 (= I456), D38 (= D475), L39 (≠ M476), A60 (≠ L502), N61 (= N503), V62 (= V504), N88 (= N530), V111 (= V553), S140 (= S583), Y155 (= Y596), K159 (= K600), I188 (≠ V629), T190 (≠ S631)
1gegE Cryatal structure analysis of meso-2,3-butanediol dehydrogenase (see paper)
34% identity, 36% coverage: 445:700/706 of query aligns to 3:253/256 of 1gegE
- active site: G13 (= G455), S139 (= S583), Y152 (= Y596), K156 (= K600), V197 (vs. gap)
- binding alpha-D-glucopyranose: R63 (≠ E507), D64 (≠ E508), F67 (≠ K511), E123 (≠ N567)
- binding nicotinamide-adenine-dinucleotide: G9 (= G451), Q12 (≠ G454), I14 (= I456), D33 (= D475), Y34 (≠ M476), V58 (≠ L502), D59 (≠ N503), V60 (= V504), N86 (= N530), A87 (= A531), I109 (≠ V553), S139 (= S583), Y152 (= Y596), K156 (= K600), P182 (= P626), V185 (≠ S631), T187 (≠ S633), M189 (≠ I635)
F1SWA0 Zerumbone synthase; EC 1.1.1.326 from Zingiber zerumbet (Shampoo ginger) (Amomum zerumbet) (see paper)
30% identity, 37% coverage: 442:703/706 of query aligns to 3:259/267 of F1SWA0
- S142 (= S583) mutation to A: Strong reduction in oxidoreductase activity toward 8-hydroxy-alpha-humulene and borneol.
- S144 (≠ N585) mutation to A: Increased oxidoreductase activity toward 8-hydroxy-alpha-humulene and borneol.
- Y155 (= Y596) mutation to A: Strong reduction in oxidoreductase activity toward 8-hydroxy-alpha-humulene and borneol.
- K159 (= K600) mutation to A: Abolishes all oxidoreductase activity.
Q48436 Diacetyl reductase [(S)-acetoin forming]; Acetoin(diacetyl) reductase; AR; Meso-2,3-butanediol dehydrogenase; EC 1.1.1.304 from Klebsiella pneumoniae (see paper)
34% identity, 36% coverage: 445:700/706 of query aligns to 3:253/256 of Q48436
- 6:33 (vs. 448:475, 50% identical) binding
- D59 (≠ N503) binding
- K156 (= K600) binding
1zk1A Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and NAD (see paper)
31% identity, 37% coverage: 442:699/706 of query aligns to 4:247/251 of 1zk1A
- active site: G17 (= G455), S142 (= S583), Y155 (= Y596), K159 (= K600)
- binding 1-phenylethanone: A93 (≠ S534), N95 (≠ S536), Y155 (= Y596), Y189 (≠ A628)
- binding nicotinamide-adenine-dinucleotide: G13 (= G451), L16 (≠ G454), I18 (= I456), D37 (= D475), H61 (≠ K494), D62 (= D495), S63 (= S496), N89 (= N530), A90 (= A531), I92 (≠ L533), M140 (≠ I581), Y155 (= Y596), G188 (≠ D627), I190 (≠ V629), L194 (vs. gap)
1zjzA Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and NAD (see paper)
31% identity, 37% coverage: 442:699/706 of query aligns to 4:247/251 of 1zjzA
- active site: G17 (= G455), S142 (= S583), Y155 (= Y596), K159 (= K600)
- binding nicotinamide-adenine-dinucleotide: G13 (= G451), L16 (≠ G454), I18 (= I456), D37 (= D475), D62 (= D495), N89 (= N530), A90 (= A531), G91 (= G532), I92 (≠ L533), Y155 (= Y596), G188 (≠ D627), I190 (≠ V629), L194 (vs. gap)
- binding (1r)-1-phenylethanol: A93 (≠ S534), N95 (≠ S536), L152 (≠ N593), Y155 (= Y596)
1zjyA Structure of r-specific alcohol dehydrogenase (mutant g37d) from lactobacillus brevis in complex with phenylethanol and nadh (see paper)
31% identity, 37% coverage: 442:699/706 of query aligns to 4:247/251 of 1zjyA
- active site: G17 (= G455), S142 (= S583), Y155 (= Y596), K159 (= K600)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G13 (= G451), L16 (≠ G454), G17 (= G455), I18 (= I456), D37 (= D475), D62 (= D495), N89 (= N530), A90 (= A531), G91 (= G532), I92 (≠ L533), Y155 (= Y596), G188 (≠ D627), I190 (≠ V629), L194 (vs. gap)
- binding (1r)-1-phenylethanol: A93 (≠ S534), N95 (≠ S536), L152 (≠ N593), Y155 (= Y596), Y189 (≠ A628)
3ai2A The crystal structure of l-sorbose reductase from gluconobacter frateurii complexed with NADPH (see paper)
31% identity, 37% coverage: 442:700/706 of query aligns to 5:259/263 of 3ai2A
- active site: G18 (= G455), S144 (= S583), Y157 (= Y596), K161 (= K600)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G14 (= G451), S16 (≠ A453), S17 (≠ G454), G18 (= G455), I19 (= I456), A38 (≠ D475), R39 (≠ M476), Q40 (≠ N477), V64 (= V501), D65 (≠ N503), V66 (= V504), N92 (= N530), G94 (= G532), N142 (≠ I581), Y157 (= Y596), K161 (= K600), P187 (= P626), I190 (≠ V629), T192 (≠ S631), W195 (= W636)
Query Sequence
>CA265_RS02630 FitnessBrowser__Pedo557:CA265_RS02630
MSIDTKSYKHVSYLWDEEEAAKLAGDEVALLIYRSNLLGADLRLTNYGGGNTSCKVLEKD
PLTGLETEVMWVKGSGGDLGTLKKSGLAALYVDRLRSLKNIYRGVEHEDEMVELFNHCIF
DLSSKAPSIDTPLHGFLPFAHIDHLHPDAAIAIAAAKDGKKITEELFGGTIGWVEWKKPG
FELGLQLKQCLDENPGIRGIMLGSHGLFTWGDTAYESYLNTLEVIEICSDYLNQNYGKKG
PVFGGQKIESAAADQRKKQAAALAPVLRGLCSSKQHMIGHFTDDARVLEFINSNDLDRLA
PMGTSCPDHFLRTKISPLVLTLTSDADLSDVKALKETLEPAFEAYRAMYTAYYEACKHPN
SPAIRDTNPVVILYPGIGMFTFSKDKQTARVAAEFYINAINVMKGAEAVSAYTSLPHQEA
FNIEYWLLEEAKLQRMPKPKPLTGKIALITGSAGGIGKAIAKKFVAEGGVVILNDMNAER
LEEAAKEFAGLFGKDSYSTAVLNVTSEEDIKQAFDSAALAFGGVDIIVNNAGLSISKTIA
DHTEKDWDLLYDVLVKGQFFITQAATNTMQKQDIGGDIINIVSKNALVSGPNNAGYGSAK
AAQLHLSRLNAAELGADNIRVNVVNPDAVISDSNIWAGGWAEGRAKAYGITVAELPAYYA
KRTLLNQIILPDDIANACFAFVGGLLHKSTGNVLNVDGGVAMAFVR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory