Comparing CA265_RS02640 FitnessBrowser__Pedo557:CA265_RS02640 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
Q1R415 Rhamnulokinase; Rhamnulose kinase; EC 2.7.1.5 from Escherichia coli (strain UTI89 / UPEC) (see paper)
24% identity, 58% coverage: 10:276/461 of query aligns to 10:284/489 of Q1R415
Sites not aligning to the query:
P32171 L-Rhamnulokinase; RhaB; RhuK; ATP:L-rhamnulose phosphotransferase; L-rhamnulose 1-kinase; Rhamnulose kinase; EC 2.7.1.5 from Escherichia coli (strain K12) (see paper)
25% identity, 56% coverage: 10:269/461 of query aligns to 10:272/489 of P32171
Sites not aligning to the query:
2uytA Structure of l-rhamnulose kinase in complex with adp and beta-l- rhamnulose. (see paper)
24% identity, 58% coverage: 10:276/461 of query aligns to 9:283/479 of 2uytA
Sites not aligning to the query:
2cglA Crystal structure of l-rhamnulose kinase from escherichia coli in complex with l-fructose, adp and a modeled atp gamma phosphate. (see paper)
24% identity, 58% coverage: 10:276/461 of query aligns to 9:283/479 of 2cglA
Sites not aligning to the query:
2cgjA Crystal structure of l-rhamnulose kinase from escherichia coli in complex with l-fructose and adp. (see paper)
24% identity, 58% coverage: 10:276/461 of query aligns to 9:283/479 of 2cgjA
Sites not aligning to the query:
>CA265_RS02640 FitnessBrowser__Pedo557:CA265_RS02640
MPKPVIAIFDVGKTNKKLFLIDENYSIVYERSARFVETVDEDGEPCENLESLRSSVYDSL
HQVLQLKEFDVRAINFSTYGASFVYLDENGNPLTPLYNYLKEYPEALKKAFYAEYGGEEK
ISLETASPILGSLNSGMQLYRLKNEKPEIFKKVKWALHLPQYLSYLITGKAVADITSIGC
HTQLWDFNKSEYHNWVKTEKIDEKFGTFTPADSSLKTNFEGSSVKVGVGLHDSSAALIPY
LANFNTPFVLISTGTWCISLNPFNQEPLTAEELKQDCLCYMHFKGKAVKASRIFAGYEHE
VQLKRIAEHFDRAAYLFKHLKFNPSMILKLANKIPENRQEQQGFSASSAFPERDLNLFQT
AEEAYHQLIFDLIKQQIYSLKLILNTGVKRIFVDGGFGKNAIYMHLLATSIPDIEVYASS
VSQATAIGTALAINDAWNENPAPTDMIQLKYYSAIQRTIEL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory