SitesBLAST
Comparing CA265_RS03080 FitnessBrowser__Pedo557:CA265_RS03080 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P49814 Malate dehydrogenase; Vegetative protein 69; VEG69; EC 1.1.1.37 from Bacillus subtilis (strain 168) (see 2 papers)
47% identity, 98% coverage: 2:307/312 of query aligns to 7:312/312 of P49814
- S149 (≠ G144) modified: Phosphoserine
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1guzA Structural basis for thermophilic protein stability: structures of thermophilic and mesophilic malate dehydrogenases (see paper)
48% identity, 96% coverage: 1:299/312 of query aligns to 1:298/305 of 1guzA
- active site: D147 (= D148), R150 (= R151), H174 (= H175)
- binding nicotinamide-adenine-dinucleotide: G9 (= G9), N10 (≠ A10), V11 (= V11), D32 (= D32), V33 (≠ I33), T76 (= T77), G78 (= G79), L79 (= L80), P80 (= P81), I97 (= I98), V117 (≠ I118), N119 (= N120), M142 (= M143), L146 (= L147), H174 (= H175), P228 (= P229)
7byaA Malate dehydrogenase from geobacillus stearothermophilus (gs-mdh) complexed with oxaloacetic acid (oaa) and adenosine 5'- diphosphoribose (apr) (see paper)
46% identity, 98% coverage: 2:306/312 of query aligns to 6:310/311 of 7byaA
7by9A Malate dehydrogenase from geobacillus stearothermophilus (gs-mdh) complexed with oxaloacetic acid (oaa) and nicotinamide adenine dinucleotide (NAD) (see paper)
46% identity, 98% coverage: 2:306/312 of query aligns to 6:310/311 of 7by9A
- binding nicotinamide-adenine-dinucleotide: G11 (= G7), G13 (= G9), F14 (≠ A10), T15 (≠ V11), D35 (= D32), I36 (= I33), T81 (= T77), A82 (≠ S78), I102 (= I98), Q105 (≠ G101), V106 (= V102), L122 (≠ I118), N124 (= N120), V126 (≠ M122)
- binding oxaloacetate ion: L151 (= L147), R155 (= R151), H179 (= H175), G217 (= G214)
7f8dA Malate dehydrogenase from geobacillus stearothermophilus (gs-mdh) g218y mutant (see paper)
46% identity, 98% coverage: 2:306/312 of query aligns to 8:312/313 of 7f8dA
- binding nicotinamide-adenine-dinucleotide: G15 (= G9), F16 (≠ A10), T17 (≠ V11), D37 (= D32), I38 (= I33), L41 (vs. gap), Y71 (= Y65), T83 (= T77), A84 (≠ S78), G85 (= G79), L124 (≠ I118), T125 (≠ S119), N126 (= N120), Q149 (≠ M143), L153 (= L147), P235 (= P229)
4plyA Crystal structure of ancestral apicomplexan malate dehydrogenase with malate. (see paper)
46% identity, 96% coverage: 2:302/312 of query aligns to 4:312/318 of 4plyA
- active site: D153 (= D148), R156 (= R151), H180 (= H175)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G9), N12 (≠ A10), I13 (≠ V11), D33 (= D32), I34 (= I33), Y65 (= Y65), T77 (= T77), A78 (≠ S78), G79 (= G79), I80 (≠ L80), P81 (= P81), I103 (= I98), V123 (≠ I118), N125 (= N120), M148 (= M143), L152 (= L147), H180 (= H175), P239 (= P229)
- binding pyruvic acid: W91 (≠ M86), R93 (= R88), N125 (= N120), R156 (= R151), H180 (= H175), G223 (= G214)
4pltB Crystal structure of ancestral apicomplexan malate dehydrogenase with oxamate. (see paper)
46% identity, 96% coverage: 2:302/312 of query aligns to 5:313/319 of 4pltB
- active site: R94 (= R88), D154 (= D148), R157 (= R151), H181 (= H175)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G12 (= G9), N13 (≠ A10), I14 (≠ V11), F33 (≠ L31), D34 (= D32), I35 (= I33), T78 (= T77), A79 (≠ S78), G80 (= G79), I81 (≠ L80), P82 (= P81), I104 (= I98), V124 (≠ I118), N126 (= N120), M149 (= M143), H181 (= H175), P240 (= P229)
P80039 Malate dehydrogenase; EC 1.1.1.37 from Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) (Chlorobium tepidum) (see paper)
46% identity, 96% coverage: 1:299/312 of query aligns to 1:298/310 of P80039
1gv0A Structural basis for thermophilic protein stability: structures of thermophilic and mesophilic malate dehydrogenases (see paper)
45% identity, 96% coverage: 1:299/312 of query aligns to 1:294/301 of 1gv0A
- active site: D143 (= D148), R146 (= R151), H170 (= H175)
- binding nicotinamide-adenine-dinucleotide: G9 (= G9), N10 (≠ A10), V11 (= V11), D32 (= D32), V33 (≠ I33), T76 (= T77), A77 (≠ S78), G78 (= G79), L79 (= L80), P80 (= P81), V113 (≠ I118), N115 (= N120), M138 (= M143), P224 (= P229)
3gvhA Crystal structure of lactate/malate dehydrogenase from brucella melitensis
42% identity, 96% coverage: 2:302/312 of query aligns to 4:307/318 of 3gvhA
- active site: R88 (= R88), D148 (= D148), R151 (= R151), H175 (= H175)
- binding nicotinamide-adenine-dinucleotide: G11 (= G9), I13 (≠ V11), D33 (= D32), I34 (= I33), T77 (= T77), A78 (≠ S78), I118 (= I118), N120 (= N120), M143 (= M143), L147 (= L147), H175 (= H175)
4plfB Crystal structure of ancestral apicomplexan lactate dehydrogenase with lactate. (see paper)
39% identity, 99% coverage: 2:311/312 of query aligns to 6:323/330 of 4plfB
- active site: R95 (= R88), D155 (= D148), R158 (= R151), H182 (= H175)
- binding nicotinamide-adenine-dinucleotide: G13 (= G9), M14 (≠ A10), I15 (≠ V11), F34 (≠ L31), D35 (= D32), V36 (≠ I33), T79 (= T77), A80 (≠ S78), G81 (= G79), L82 (= L80), T83 (≠ P81), I105 (= I98), I125 (= I118), N127 (= N120), M150 (= M143), H182 (= H175), P241 (= P229)
- binding pyruvic acid: W93 (≠ M86), R95 (= R88), N127 (= N120), R158 (= R151), H182 (= H175)
4plcA Crystal structure of ancestral apicomplexan lactate dehydrogenase with malate. (see paper)
39% identity, 99% coverage: 2:311/312 of query aligns to 6:323/324 of 4plcA
- active site: R95 (= R88), D155 (= D148), R158 (= R151), H182 (= H175)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G13 (= G9), M14 (≠ A10), I15 (≠ V11), D35 (= D32), V36 (≠ I33), T79 (= T77), A80 (≠ S78), G81 (= G79), L82 (= L80), T83 (≠ P81), I125 (= I118), N127 (= N120), M150 (= M143), H182 (= H175), P241 (= P229)
- binding pyruvic acid: W93 (≠ M86), R95 (= R88), N127 (= N120), R158 (= R151), H182 (= H175), G225 (= G214)
1uxgA Large improvement in the thermal stability of a tetrameric malate dehydrogenase by single point mutations at the dimer-dimer interface. (see paper)
45% identity, 96% coverage: 2:300/312 of query aligns to 3:299/308 of 1uxgA
- active site: R87 (= R88), D147 (= D148), R150 (= R151), H174 (= H175)
- binding fumaric acid: R81 (= R82), R87 (= R88), L146 (= L147), R150 (= R151), H174 (= H175), G212 (= G214), S223 (= S224)
- binding nicotinamide-adenine-dinucleotide: G10 (= G9), F11 (≠ A10), V12 (= V11), D32 (= D32), T76 (= T77), S77 (= S78), G78 (= G79), A79 (≠ L80), P80 (= P81), C101 (≠ V102), V117 (≠ I118), N119 (= N120), Q142 (≠ M143), H174 (= H175), P228 (= P229)
P80040 Malate dehydrogenase; EC 1.1.1.37 from Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) (see 2 papers)
44% identity, 96% coverage: 2:300/312 of query aligns to 4:300/309 of P80040
4rosA Crystal structure of methylobacterium extorquens malate dehydrogenase complexed with oxaloacetate and adenosine-5-diphosphoribose
42% identity, 96% coverage: 2:302/312 of query aligns to 4:307/318 of 4rosA
- active site: R88 (= R88), D148 (= D148), R151 (= R151), H175 (= H175)
- binding adenosine-5-diphosphoribose: G11 (= G9), Q12 (≠ A10), I13 (≠ V11), D33 (= D32), I34 (= I33), T77 (= T77), A78 (≠ S78), G79 (= G79), V80 (≠ L80), P81 (= P81), V98 (≠ I98), T119 (≠ S119), N120 (= N120)
- binding oxaloacetate ion: R82 (= R82), R88 (= R88), N120 (= N120), L147 (= L147), R151 (= R151), H175 (= H175), G218 (= G214)
5ujkA Malate dehydrogenase from methylobacterium extorquens, complexed with NAD (see paper)
42% identity, 96% coverage: 2:302/312 of query aligns to 4:307/315 of 5ujkA
- active site: R88 (= R88), D148 (= D148), R151 (= R151), H175 (= H175)
- binding nicotinamide-adenine-dinucleotide: G11 (= G9), Q12 (≠ A10), I13 (≠ V11), D33 (= D32), I34 (= I33), T77 (= T77), A78 (≠ S78), G79 (= G79), V98 (≠ I98), I118 (= I118), N120 (= N120), M143 (= M143), L147 (= L147), H175 (= H175)
3gviA Crystal structure of lactate/malate dehydrogenase from brucella melitensis in complex with adp
40% identity, 96% coverage: 2:302/312 of query aligns to 4:302/314 of 3gviA
2hjrB Crystal structure of cryptosporidium parvum malate dehydrogenase (see paper)
40% identity, 96% coverage: 2:302/312 of query aligns to 4:307/314 of 2hjrB
- active site: R88 (= R88), D148 (= D148), R151 (= R151), H175 (= H175)
- binding adenosine-5-diphosphoribose: G11 (= G9), Q12 (≠ A10), I13 (≠ V11), D33 (= D32), I34 (= I33), I35 (≠ K34), Y65 (= Y65), T77 (= T77), A78 (≠ S78), G79 (= G79), V80 (≠ L80), P81 (= P81), T119 (≠ S119), N120 (= N120)
6vdjA Crystal structure of ancestral apicomplexan lactate dehydrogenase with sulfate and nadh4.
40% identity, 98% coverage: 2:306/312 of query aligns to 4:304/308 of 6vdjA
- binding 1,4,5,6-tetrahydronicotinamide adenine dinucleotide: G11 (= G9), M12 (≠ A10), I13 (≠ V11), D33 (= D32), V34 (≠ I33), A78 (≠ S78), I91 (= I98), I111 (= I118), T112 (≠ S119), N113 (= N120), M136 (= M143), H168 (= H175)
1sowA T. Gondii bradyzoite-specific ldh (ldh2) in complex with NAD and oxalate
38% identity, 99% coverage: 2:309/312 of query aligns to 7:322/322 of 1sowA
- active site: R96 (= R88), D156 (= D148), R159 (= R151), H183 (= H175)
- binding nicotinamide-adenine-dinucleotide: G14 (= G9), M15 (≠ A10), I16 (≠ V11), D36 (= D32), V37 (≠ I33), T80 (= T77), A81 (≠ S78), G82 (= G79), L83 (= L80), T84 (≠ P81), I106 (= I98), E109 (≠ G101), V126 (≠ I118), T127 (≠ S119), N128 (= N120), M151 (= M143), L155 (= L147), H183 (= H175), P242 (= P229)
- binding oxalate ion: W94 (≠ M86), R96 (= R88), R159 (= R151), H183 (= H175), G226 (= G214)
Query Sequence
>CA265_RS03080 FitnessBrowser__Pedo557:CA265_RS03080
MKVTVVGAGAVGATCADNIARKELANELVLLDIKEGFAEGKAIDMMQTATLLGFDTKITG
VTGDYSKTAGSDVVVITSGLPRKPGMTREELIGINAGIVKGVAENILKFSPEAIFIVISN
PMDTMTYLALKSLGLPKNRIIGMGGTLDSSRFKFYLSQALNCNPNDLQGFVIGGHGDTTM
IPLTRLATYQSLPVSNLLDKATLDKVAADTMVGGATLTGLIGTSAWYAPGAAGAALVEAI
LRDEKKLFTCCVSLEGEYGQEDICLGVPVIIGRNGWEKIIDFKLTDDEQAAFNKSADAVR
NMNSVLAEMKLV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory