Comparing CA265_RS03145 FitnessBrowser__Pedo557:CA265_RS03145 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3r6oA Crystal structure of a probable 2-hydroxyhepta-2,4-diene-1, 7- dioateisomerase from mycobacterium abscessus (see paper)
32% identity, 61% coverage: 111:313/331 of query aligns to 77:256/265 of 3r6oA
8skyB Crystal structure of yisk from bacillus subtilis in complex with oxalate (see paper)
27% identity, 96% coverage: 1:317/331 of query aligns to 1:300/303 of 8skyB
8sutA Crystal structure of yisk from bacillus subtilis in complex with reaction product 4-hydroxy-2-oxoglutaric acid (see paper)
27% identity, 96% coverage: 1:317/331 of query aligns to 2:301/303 of 8sutA
5ti1H Crystal structure of fumarylacetoacetate hydrolase from burkholderia xenovorans lb400
30% identity, 71% coverage: 52:285/331 of query aligns to 110:382/430 of 5ti1H
6v77B Crystal structure of a putative hpce protein from mycobacterium smegmatis
30% identity, 64% coverage: 109:321/331 of query aligns to 92:279/279 of 6v77B
6j5xB Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
27% identity, 84% coverage: 39:315/331 of query aligns to 29:274/280 of 6j5xB
6j5xA Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
27% identity, 84% coverage: 39:315/331 of query aligns to 29:274/280 of 6j5xA
8gstC Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Pyruvate bound-form) (see paper)
28% identity, 63% coverage: 111:319/331 of query aligns to 95:280/290 of 8gstC
Sites not aligning to the query:
8gsrA Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Apo-form) (see paper)
28% identity, 63% coverage: 111:319/331 of query aligns to 95:280/290 of 8gsrA
P35505 Fumarylacetoacetase; FAA; Beta-diketonase; Fumarylacetoacetate hydrolase; EC 3.7.1.2 from Mus musculus (Mouse) (see 3 papers)
29% identity, 61% coverage: 84:285/331 of query aligns to 126:369/419 of P35505
2hzyA Mouse fumarylacetoacetate hydrolase complexes with a transition-state mimic of the complete substrate (see paper)
29% identity, 61% coverage: 84:285/331 of query aligns to 126:369/416 of 2hzyA
Sites not aligning to the query:
1qcoA Crystal structure of fumarylacetoacetate hydrolase complexed with fumarate and acetoacetate (see paper)
29% identity, 61% coverage: 84:285/331 of query aligns to 126:369/416 of 1qcoA
1hyoB Crystal structure of fumarylacetoacetate hydrolase complexed with 4- (hydroxymethylphosphinoyl)-3-oxo-butanoic acid (see paper)
29% identity, 61% coverage: 84:285/331 of query aligns to 128:371/419 of 1hyoB
4dbhA Crystal structure of cg1458 with inhibitor (see paper)
27% identity, 75% coverage: 72:320/331 of query aligns to 55:269/269 of 4dbhA
3lzkC The crystal structure of a probably aromatic amino acid degradation protein from sinorhizobium meliloti 1021
26% identity, 93% coverage: 1:307/331 of query aligns to 7:322/343 of 3lzkC
6iymA Fumarylacetoacetate hydrolase (eafah) from psychrophilic exiguobacterium antarcticum (see paper)
27% identity, 96% coverage: 1:317/331 of query aligns to 2:274/277 of 6iymA
P16930 Fumarylacetoacetase; FAA; Beta-diketonase; Fumarylacetoacetate hydrolase; EC 3.7.1.2 from Homo sapiens (Human) (see 14 papers)
28% identity, 61% coverage: 84:285/331 of query aligns to 126:369/419 of P16930
Sites not aligning to the query:
3qdfA Crystal structure of 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from mycobacterium marinum (see paper)
30% identity, 63% coverage: 111:319/331 of query aligns to 76:249/252 of 3qdfA
1gttA Crystal structure of hpce (see paper)
29% identity, 50% coverage: 109:272/331 of query aligns to 237:387/421 of 1gttA
6j5yA Crystal structure of fumarylpyruvate hydrolase from pseudomonas aeruginosa in complex with mn2+ and pyruvate (see paper)
27% identity, 50% coverage: 109:272/331 of query aligns to 47:203/233 of 6j5yA
Sites not aligning to the query:
>CA265_RS03145 FitnessBrowser__Pedo557:CA265_RS03145
MKLVSYKTEDREHLGVFVNGHIYNLNSCDKLIPDNMSEFLQGGEVLMERAKRIDDQIKDG
SLAAKEEIFYEILAPVPHPTSCRDGYAFRQHVAAARRNRKVDMIPQFDEYPIFYFTNHNA
IQGTGEIECMPDHFDKLDFELEIAIVIGKKGRNIKAAEADEYIAGYMVMNDMSARTLQME
EMLLNLGPAKGKDFSTVIGPWLVTPDELLQYKVAPKAGHVGHAYDLKMTCRVNGIEVSKG
NAADMDWTFAEIIERCAYGVDILPGDVIGSGTVGTGCFLELNGTGLLNDPNYKVQWLQPG
DVVEMEITGLGALTNTITKANTDFSILALKK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory