Comparing CA265_RS03605 FitnessBrowser__Pedo557:CA265_RS03605 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
6j2lA Crystal structure of bi-functional enzyme (see paper)
54% identity, 96% coverage: 8:198/200 of query aligns to 9:200/200 of 6j2lA
6j2lB Crystal structure of bi-functional enzyme (see paper)
50% identity, 96% coverage: 8:198/200 of query aligns to 8:185/185 of 6j2lB
7bgnA Crystal structure of mthisn2-amp complex, a bifunctional enzyme from the histidine biosynthetic pathway (see paper)
36% identity, 96% coverage: 7:198/200 of query aligns to 8:203/204 of 7bgnA
Sites not aligning to the query:
7bgmA Crystal structure of mthisn2, a bifunctional enzyme from the histidine biosynthetic pathway (see paper)
33% identity, 96% coverage: 7:198/200 of query aligns to 10:212/213 of 7bgmA
>CA265_RS03605 FitnessBrowser__Pedo557:CA265_RS03605
MNIDTSSLDWDKTAGLLPVIIQDYKTLEVLMLGYMNAEALEKTQAEGKVTFFSRSKNRLW
TKGETSNNFLYVKELFVDCDHDTILIKADAVGPTCHTGSRSCFKTDYNQNFIFELENIIN
DRYENPVEGSYINKMRNKGLNKIAQKVGEEGVETVIAALAETEEELIGEASDLVFHLLFL
LKEKGLSIQDIAKNLEKRHQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory