Comparing CA265_RS03655 FitnessBrowser__Pedo557:CA265_RS03655 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0A717 Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 from Escherichia coli (strain K12) (see 4 papers)
29% identity, 79% coverage: 24:241/277 of query aligns to 35:254/315 of P0A717
Sites not aligning to the query:
6asvC E. Coli prpp synthetase (see paper)
29% identity, 79% coverage: 24:241/277 of query aligns to 33:252/311 of 6asvC
4s2uA Crystal structure of the phosphorybosylpyrophosphate synthetase from e. Coli
29% identity, 79% coverage: 24:241/277 of query aligns to 34:253/308 of 4s2uA
7xmvA E.Coli phosphoribosylpyrophosphate (prpp) synthetase type a(amp/adp) filament bound with adp, amp and r5p (see paper)
29% identity, 79% coverage: 24:241/277 of query aligns to 33:246/307 of 7xmvA
7xmuA E.Coli phosphoribosylpyrophosphate (prpp) synthetase type a filament bound with adp, pi and r5p (see paper)
29% identity, 79% coverage: 24:241/277 of query aligns to 33:246/307 of 7xmuA
P9WKE3 Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
28% identity, 66% coverage: 60:241/277 of query aligns to 80:264/326 of P9WKE3
Sites not aligning to the query:
6nfeA Crystal structure of ribose-phosphate pyrophosphokinase from legionella pneumophila with bound amp, adp, and ribose-5-phosphate
27% identity, 75% coverage: 53:260/277 of query aligns to 64:268/298 of 6nfeA
Sites not aligning to the query:
Q97Z86 Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
24% identity, 83% coverage: 16:246/277 of query aligns to 24:255/291 of Q97Z86
6nfeB Crystal structure of ribose-phosphate pyrophosphokinase from legionella pneumophila with bound amp, adp, and ribose-5-phosphate
27% identity, 75% coverage: 53:260/277 of query aligns to 64:269/299 of 6nfeB
Sites not aligning to the query:
3lpnA Crystal structure of the phosphoribosylpyrophosphate (prpp) synthetase from thermoplasma volcanium in complex with an atp analog (ampcpp). (see paper)
28% identity, 74% coverage: 58:261/277 of query aligns to 65:265/284 of 3lpnA
Sites not aligning to the query:
P14193 Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PPRibP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 from Bacillus subtilis (strain 168) (see 4 papers)
24% identity, 90% coverage: 24:272/277 of query aligns to 41:291/317 of P14193
Sites not aligning to the query:
3mbiA Crystal structure of the phosphoribosylpyrophosphate (prpp) synthetase from thermoplasma volcanium in complex with adp-mg2+ and ribose 5- phosphate (see paper)
28% identity, 74% coverage: 58:261/277 of query aligns to 67:267/287 of 3mbiA
Sites not aligning to the query:
3mbiD Crystal structure of the phosphoribosylpyrophosphate (prpp) synthetase from thermoplasma volcanium in complex with adp-mg2+ and ribose 5- phosphate (see paper)
28% identity, 74% coverage: 58:261/277 of query aligns to 65:265/285 of 3mbiD
Sites not aligning to the query:
Q97CA5 Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 from Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) (see paper)
28% identity, 74% coverage: 58:261/277 of query aligns to 65:265/286 of Q97CA5
Sites not aligning to the query:
Q58761 Ribose-phosphate pyrophosphokinase; RPPK; 5-phospho-D-ribosyl alpha-1-diphosphate synthase; Phosphoribosyl diphosphate synthase; Phosphoribosyl pyrophosphate synthase; P-Rib-PP synthase; PRPP synthase; PRPPase; EC 2.7.6.1 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
28% identity, 92% coverage: 17:271/277 of query aligns to 27:279/284 of Q58761
4twbA Sulfolobus solfataricus ribose-phosphate pyrophosphokinase (see paper)
23% identity, 83% coverage: 16:246/277 of query aligns to 24:242/278 of 4twbA
1dkuA Crystal structures of bacillus subtilis phosphoribosylpyrophosphate synthetase: molecular basis of allosteric inhibition and activation. (see paper)
24% identity, 86% coverage: 24:261/277 of query aligns to 33:263/295 of 1dkuA
Sites not aligning to the query:
1u9zA Crystal structure of phosphoribosyl diphosphate synthase complexed with amp and ribose 5-phosphate (see paper)
27% identity, 92% coverage: 17:271/277 of query aligns to 27:269/274 of 1u9zA
1ibsB Phosphoribosyldiphosphate synthetase in complex with cadmium ions (see paper)
24% identity, 90% coverage: 24:272/277 of query aligns to 35:274/299 of 1ibsB
1ibsA Phosphoribosyldiphosphate synthetase in complex with cadmium ions (see paper)
24% identity, 90% coverage: 24:272/277 of query aligns to 33:272/297 of 1ibsA
>CA265_RS03655 FitnessBrowser__Pedo557:CA265_RS03655
MLNLNPGFTPLGENNLIEYKSFLFAGGEPHIKISNNFDAALPITITHRINSFNDLGLICI
TVDALKRMGVKEIHLFIPYFPAARQDRVMIPGEPLSVKVYADIINAMALANVTIFDPHSE
VSPALLNNCVTISNHEFIKQVIAKIGTDVKLISPDGGALKKIYKVSEFLDGAEVIECSKS
RDVKTGKLSGFKVYAEDLAGADCLIVDDICDGGGTFIGLSEALKAKNAGKLYLAISHGIF
SKGFDELDKYFEQIFTTDSIKEVDHKGVTQIKLQKIL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory