Comparing CA265_RS04075 FitnessBrowser__Pedo557:CA265_RS04075 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5o5cB The crystal structure of dfoj, the desferrioxamine biosynthetic pathway lysine decarboxylase from the fire blight disease pathogen erwinia amylovora (see paper)
46% identity, 94% coverage: 19:502/513 of query aligns to 1:466/468 of 5o5cB
A7B1V0 Tryptophan decarboxylase; Trp decarboxylase; EC 4.1.1.105 from Ruminococcus gnavus (strain ATCC 29149 / VPI C7-9) (see paper)
30% identity, 80% coverage: 97:506/513 of query aligns to 91:490/490 of A7B1V0
4obvC Ruminococcus gnavus tryptophan decarboxylase rumgna_01526 (alpha-fmt) (see paper)
30% identity, 79% coverage: 97:499/513 of query aligns to 76:464/471 of 4obvC
4obuA Ruminococcus gnavus tryptophan decarboxylase rumgna_01526 (apo) (see paper)
29% identity, 80% coverage: 98:506/513 of query aligns to 77:462/462 of 4obuA
Q05683 Glutamate decarboxylase 2; 65 kDa glutamic acid decarboxylase; GAD-65; Glutamate decarboxylase 65 kDa isoform; EC 4.1.1.15 from Rattus norvegicus (Rat) (see 2 papers)
30% identity, 81% coverage: 87:499/513 of query aligns to 164:584/585 of Q05683
Sites not aligning to the query:
Q05329 Glutamate decarboxylase 2; 65 kDa glutamic acid decarboxylase; GAD-65; Glutamate decarboxylase 65 kDa isoform; EC 4.1.1.15 from Homo sapiens (Human) (see 3 papers)
30% identity, 81% coverage: 87:499/513 of query aligns to 164:584/585 of Q05329
Sites not aligning to the query:
Q80WP8 Acidic amino acid decarboxylase GADL1; Aspartate 1-decarboxylase; ADC; Cysteine sulfinic acid decarboxylase; CSADC; Glutamate decarboxylase-like protein 1; EC 4.1.1.11; EC 4.1.1.29 from Mus musculus (Mouse) (see paper)
30% identity, 78% coverage: 39:439/513 of query aligns to 86:479/550 of Q80WP8
6enzA Crystal structure of mouse gadl1 (see paper)
30% identity, 78% coverage: 39:439/513 of query aligns to 28:416/487 of 6enzA
3vp6A Structural characterization of glutamic acid decarboxylase; insights into the mechanism of autoinactivation (see paper)
30% identity, 79% coverage: 92:497/513 of query aligns to 86:499/500 of 3vp6A
2okkA The x-ray crystal structure of the 65kda isoform of glutamic acid decarboxylase (gad65) (see paper)
29% identity, 81% coverage: 87:499/513 of query aligns to 77:483/483 of 2okkA
Q99259 Glutamate decarboxylase 1; 67 kDa glutamic acid decarboxylase; GAD-67; Glutamate decarboxylase 67 kDa isoform; EC 4.1.1.15 from Homo sapiens (Human) (see 4 papers)
29% identity, 80% coverage: 92:499/513 of query aligns to 178:593/594 of Q99259
Sites not aligning to the query:
2okjB The x-ray crystal structure of the 67kda isoform of glutamic acid decarboxylase (gad67) (see paper)
29% identity, 80% coverage: 92:499/513 of query aligns to 86:501/504 of 2okjB
2jisB Human cysteine sulfinic acid decarboxylase (csad) in complex with plp.
26% identity, 90% coverage: 39:499/513 of query aligns to 23:486/487 of 2jisB
6zekA Crystal structure of mouse csad (see paper)
26% identity, 88% coverage: 39:487/513 of query aligns to 17:463/476 of 6zekA
4rlgD The clear crystal structure of pyridoxal-dependent decarboxylase from sphaerobacter thermophilus dsm 20745
28% identity, 84% coverage: 63:495/513 of query aligns to 45:467/470 of 4rlgD
4rizC The crystal structure of y333q mutant pyridoxal-dependent decarboxylase from sphaerobacter thermophilus dsm 20745
29% identity, 78% coverage: 98:495/513 of query aligns to 83:472/476 of 4rizC
8oraA Human holo aromatic l-amino acid decarboxylase (aadc) external aldimine with l-dopa methylester (see paper)
24% identity, 88% coverage: 49:502/513 of query aligns to 25:476/480 of 8oraA
P20711 Aromatic-L-amino-acid decarboxylase; AADC; DOPA decarboxylase; DDC; EC 4.1.1.28 from Homo sapiens (Human) (see 8 papers)
24% identity, 88% coverage: 49:502/513 of query aligns to 25:476/480 of P20711
Sites not aligning to the query:
P05031 Aromatic-L-amino-acid decarboxylase; AADC; DOPA decarboxylase; DDC; EC 4.1.1.28 from Drosophila melanogaster (Fruit fly) (see 3 papers)
26% identity, 89% coverage: 43:499/513 of query aligns to 52:505/510 of P05031
Sites not aligning to the query:
7xinA Crystal structure of dodc from pseudomonas
25% identity, 86% coverage: 57:496/513 of query aligns to 33:469/470 of 7xinA
>CA265_RS04075 FitnessBrowser__Pedo557:CA265_RS04075
MFTSDLEKHELIDFLTESPTKEIFHHENEAEYLHAVGKVTQAVKKFLNNNQQPFSGVSPS
KLRPLFDSIEFEKTHDNYDALLKEVEQLYTSHAVAFHHPAYIAHLNCPIVIPAVAAEVMI
SAINSSIDTWDQSAGGTLIEQKLIEWTCDQIGYSKKSDGIFTSGGTQSNLMGLLLARDHY
SITALNHNIKVEGLPQEASRFRIFVSEKAHFSIQKNASLLGLGEKSVIKIKTDRSFRMNT
VLLEDAIKREIAQGNIPIAIVGTAGTTDFGNVDPLKELASISKKYHTWFHIDAAYGCGLL
LTDKYRSLLNGIELAHSVTVDYHKSFFQPVSSSGFLVRDKNFFNLITHHADYLNPKDHDE
DGLPNQVNKSIQTTRRFDALKLWFTLRMMGRNKLGGYFDTIIETAAKIADLLHADSDFEL
MNESDISALVFRYRPKNVQLDVCAMNQYIKKAMFNQGKALVAGTKINQQFYLKFTLLNPL
TTISDIENIIKIIKKHGNEYVRLNQASADFRRN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory