SitesBLAST
Comparing CA265_RS04220 FitnessBrowser__Pedo557:CA265_RS04220 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P11170 Sodium/glucose cotransporter 1; Na(+)/glucose cotransporter 1; High affinity sodium-glucose cotransporter; Solute carrier family 5 member 1 from Oryctolagus cuniculus (Rabbit) (see 2 papers)
33% identity, 88% coverage: 3:486/550 of query aligns to 25:534/662 of P11170
- C255 (vs. gap) modified: Disulfide link with 608
- Q457 (≠ N418) mutation to W: Drasticly decreased affinity for glucose and phlorizin.
- T460 (≠ I421) mutation to W: Decreased affinity for glucose and phlorizin.
Sites not aligning to the query:
- 608 modified: Disulfide link with 255
Q9NY91 Probable glucose sensor protein SLC5A4; Solute carrier family 5 member 4 from Homo sapiens (Human) (see paper)
31% identity, 85% coverage: 3:469/550 of query aligns to 25:508/659 of Q9NY91
- E457 (≠ N418) mutation to Q: Confers sugar transport activity not found in the wild-type protein. Increased sensitivity to inhibitor phlorizin.
7wmvA Structure of human sglt1-map17 complex bound with lx2761 (see paper)
33% identity, 90% coverage: 3:497/550 of query aligns to 8:528/602 of 7wmvA
- binding N-[2-(dimethylamino)ethyl]-2-methyl-2-[4-[4-[[2-methyl-5-[(2S,3R,4R,5S,6R)-6-methylsulfanyl-3,4,5-tris(oxidanyl)oxan-2-yl]phenyl]methyl]phenyl]butanoylamino]propanamide: N61 (= N59), H66 (= H64), L70 (= L68), I81 (≠ N79), F84 (= F82), L257 (≠ M237), M266 (≠ Y246), L269 (= L249), T270 (≠ G250), Y273 (= Y253), W274 (= W254), F436 (= F414), D437 (≠ N415), Q440 (≠ N418), H508 (≠ P477)
P13866 Sodium/glucose cotransporter 1; Na(+)/glucose cotransporter 1; High affinity sodium-glucose cotransporter; Solute carrier family 5 member 1 from Homo sapiens (Human) (see 6 papers)
33% identity, 90% coverage: 3:497/550 of query aligns to 25:545/664 of P13866
- N51 (≠ K29) to S: in GGM; slightly decreased activity; dbSNP:rs17683011
- W67 (= W48) mutation to A: Strong reduction in D-glucose transporter activity.
- S77 (≠ T58) mutation to A: Loss of activity.
- H83 (= H64) mutation to L: Acquires D-mannose, D-fructose and L-sorbose transporter activity; when associated with A-287 and C-290.; mutation to Q: Loss of D-glucose transporter activity.
- R135 (= R116) to W: in GGM; loss of activity
- S159 (≠ A139) to P: in GGM; loss of activity
- A166 (≠ G146) to T: in GGM; about 90% reduction in activity
- D204 (≠ E184) mutation to A: Loss of activity.
- N248 (= N220) modified: carbohydrate, N-linked (GlcNAc...) asparagine; mutation to Q: Loss of N-glycosylation.
- C255 (≠ M227) modified: Disulfide link with 511
- W276 (= W239) to L: in GGM; about 95% reduction in activity
- T287 (≠ G250) mutation to A: Acquires D-mannose, D-fructose and L-sorbose transporter activity; when associated with L-83 and C-290.; mutation to N: Loss of D-glucose transporter activity. Has strict selectivity for D-galactose.; mutation T->S,A: Has normal D-glucose and D-galactose transporter activity.
- Y290 (= Y253) mutation to C: Loss of D-galactose transporter activity. Has strict selectivity for D-glucose. Acquires D-mannose, D-fructose and L-sorbose transporter activity; when associated with A-287 and L-83.
- W291 (= W254) mutation to A: Loss of D-glucose transporter activity.
- C292 (= C255) to Y: in GGM; loss of activity; mutation to A: Has no effect on water permeability.
- Q295 (= Q258) to R: in GGM; loss of activity
- R300 (= R263) to S: in GGM; loss of activity
- A304 (= A267) to V: in GGM; impairs trafficking to the plasma membrane
- K321 (= K284) mutation to Q: Acquires D-mannose and D-allose transporter activity comparable to glucose and galactose.
- C345 (≠ D308) modified: Disulfide link with 351
- C351 (≠ T314) modified: Disulfide link with 345
- C355 (≠ N318) modified: Disulfide link with 361
- C361 (≠ N324) modified: Disulfide link with 355
- N363 (≠ K326) mutation to A: Loss of water permeation.
- L369 (≠ M332) to S: in GGM; loss of activity
- R379 (≠ V342) to Q: in GGM; loss of activity
- A388 (≠ S351) to V: in GGM; loss of activity
- S396 (≠ G359) mutation to A: Loss of activity.
- F405 (≠ S368) to S: in GGM; loss of activity
- A411 (≠ K374) to T: in GGM; slightly decreased activity; dbSNP:rs17683430
- G426 (= G389) to R: in GGM; loss of activity
- Q451 (vs. gap) mutation to A: Strong reduction in water permeation.
- L452 (= L413) mutation to A: Loss of water permeation.
- D454 (≠ N415) mutation to A: Has no effect on water permeation.
- Q457 (≠ N418) mutation to A: Loss of D-glucose transporter activity.; mutation to C: Strong reduction in D-glucose transporter activity.
- T460 (≠ I421) mutation to A: Loss of D-glucose transporter activity.
- V470 (= V431) to N: in GGM; about 90% reduction in activity; requires 2 nucleotide substitutions
- R499 (≠ V460) to H: in GGM; impairs trafficking to the plasma membrane; decreases the sugar affinity
- C511 (vs. gap) modified: Disulfide link with 255
- C517 (vs. gap) modified: Disulfide link with 522
- C522 (≠ G474) modified: Disulfide link with 517
Sites not aligning to the query:
- 191:664 natural variant: Missing (in GGM; loss of activity)
- 379:664 natural variant: Missing (in GGM; loss of activity)
- 615 H → Q: in GGM; slightly decreased activity
- 641 W→A: Slightly reduced D-glucose transporter activity.
- 660:661 HA→WG: Loss of D-glucose transporter activity.
7slaA Cryoem structure of sglt1 at 3.15 angstrom resolution (see paper)
31% identity, 99% coverage: 3:549/550 of query aligns to 7:576/585 of 7slaA
7sl8A Cryoem structure of sglt1 at 3.4 a resolution (see paper)
31% identity, 99% coverage: 3:549/550 of query aligns to 6:573/582 of 7sl8A
8hezA Structure of human sglt2-map17 complex with dapagliflozin (see paper)
33% identity, 81% coverage: 3:446/550 of query aligns to 2:465/582 of 8hezA
- binding (2S,3R,4R,5S,6R)-2-[4-chloranyl-3-[(4-ethoxyphenyl)methyl]phenyl]-6-(hydroxymethyl)oxane-3,4,5-triol: N55 (= N59), G59 (≠ L63), H60 (= H64), G63 (≠ S67), L64 (= L68), T67 (≠ S71), F78 (= F82), E79 (= E83), V266 (≠ L249), S267 (≠ G250), W271 (= W254), K301 (= K284), F433 (= F414), Q437 (≠ N418)
- binding sodium ion: A53 (= A57), I56 (= I60), G57 (≠ S61), A369 (≠ G352), S372 (= S355), S373 (≠ Q356)
Sites not aligning to the query:
8hdhA Structure of human sglt2-map17 complex with canagliflozin (see paper)
33% identity, 81% coverage: 3:446/550 of query aligns to 2:465/586 of 8hdhA
- binding (2~{S},3~{R},4~{R},5~{S},6~{R})-2-[3-[[5-(4-fluorophenyl)thiophen-2-yl]methyl]-4-methyl-phenyl]-6-(hydroxymethyl)oxane-3,4,5-triol: N55 (= N59), G59 (≠ L63), H60 (= H64), G63 (≠ S67), L64 (= L68), F78 (= F82), E79 (= E83), S267 (≠ G250), W271 (= W254), F433 (= F414), D434 (≠ N415), Q437 (≠ N418)
- binding sodium ion: A53 (= A57), S54 (≠ T58), I56 (= I60), G57 (≠ S61), A369 (≠ G352), S372 (= S355), S373 (≠ Q356)
Sites not aligning to the query:
- binding (2~{S},3~{R},4~{R},5~{S},6~{R})-2-[3-[[5-(4-fluorophenyl)thiophen-2-yl]methyl]-4-methyl-phenyl]-6-(hydroxymethyl)oxane-3,4,5-triol: 506
- binding : 575, 579, 580, 583, 584
8hb0A Structure of human sglt2-map17 complex with ta1887 (see paper)
33% identity, 81% coverage: 3:446/550 of query aligns to 2:465/586 of 8hb0A
- binding (2R,3R,4S,5S,6R)-2-[3-[(4-cyclopropylphenyl)methyl]-4-fluoranyl-indol-1-yl]-6-(hydroxymethyl)oxane-3,4,5-triol: N55 (= N59), H60 (= H64), G63 (≠ S67), L64 (= L68), T67 (≠ S71), V75 (≠ N79), F78 (= F82), E79 (= E83), V137 (≠ F140), V266 (≠ L249), S267 (≠ G250), W271 (= W254), F433 (= F414), Q437 (≠ N418)
- binding sodium ion: A53 (= A57), I56 (= I60), G57 (≠ S61), A369 (≠ G352), S372 (= S355), S373 (≠ Q356)
Sites not aligning to the query:
7vsiA Structure of human sglt2-map17 complex bound with empagliflozin (see paper)
33% identity, 81% coverage: 3:446/550 of query aligns to 2:465/586 of 7vsiA
- binding (2S,3R,4R,5S,6R)-2-[4-chloranyl-3-[[4-[(3S)-oxolan-3-yl]oxyphenyl]methyl]phenyl]-6-(hydroxymethyl)oxane-3,4,5-triol: N55 (= N59), H60 (= H64), G63 (≠ S67), L64 (= L68), V75 (≠ N79), F78 (= F82), E79 (= E83), V266 (≠ L249), S267 (≠ G250), Y270 (= Y253), F433 (= F414), D434 (≠ N415), Q437 (≠ N418)
P31639 Sodium/glucose cotransporter 2; Na(+)/glucose cotransporter 2; Low affinity sodium-glucose cotransporter; Solute carrier family 5 member 2 from Homo sapiens (Human) (see paper)
33% identity, 81% coverage: 3:446/550 of query aligns to 22:485/672 of P31639
- V95 (≠ N79) mutation to A: Strong reduction in D-glucose transporter activity. Confers partial resistance to empagliflozin inhibition.
- F98 (= F82) mutation to A: Slightly decreases D-glucose transporter activity. Abolishes the binding to inhibitor, empagliflozin.
- V157 (≠ F140) mutation to A: Decreases D-glucose transporter activity.
- L283 (≠ Y246) mutation to M: Strong reduction in D-glucose transporter activity. Confers partial resistance to empagliflozin inhibition.
- F453 (= F414) mutation to A: Slightly decreases D-glucose transporter activity. Greatly reduces the binding to inhibitor, empagliflozin.
8hg7A Structure of human sglt2-map17 complex with sotagliflozin (see paper)
33% identity, 81% coverage: 3:446/550 of query aligns to 2:465/590 of 8hg7A
- binding (2S,3R,4R,5S,6R)-2-[4-chloranyl-3-[(4-ethoxyphenyl)methyl]phenyl]-6-methylsulfanyl-oxane-3,4,5-triol: N55 (= N59), G59 (≠ L63), H60 (= H64), G63 (≠ S67), L64 (= L68), E79 (= E83), V266 (≠ L249), S267 (≠ G250), Y270 (= Y253), W271 (= W254), K301 (= K284), F433 (= F414), Q437 (≠ N418)
- binding sodium ion: A53 (= A57), S54 (≠ T58), I56 (= I60), G57 (≠ S61), A369 (≠ G352), S372 (= S355), S373 (≠ Q356)
Sites not aligning to the query:
8hinA Structure of human sglt2-map17 complex with phlorizin (see paper)
31% identity, 81% coverage: 3:446/550 of query aligns to 9:461/588 of 8hinA
- binding 1-[2-[(2S,3R,4S,5S,6R)-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-4,6-bis(oxidanyl)phenyl]-3-(4-hydroxyphenyl)propan-1-one: S46 (≠ A54), A49 (= A57), S50 (≠ T58), G53 (≠ S61), D177 (≠ E184), T181 (≠ S188), R276 (= R263), S369 (≠ Q356)
Sites not aligning to the query:
7yniA Structure of human sglt1-map17 complex bound with substrate 4d4fdg in the occluded conformation (see paper)
32% identity, 90% coverage: 3:497/550 of query aligns to 7:499/566 of 7yniA
- binding (2R,3R,4R,5S,6R)-5-fluoranyl-6-(hydroxymethyl)oxane-2,3,4-triol: H51 (= H64), E70 (= E83), L248 (= L249), Y252 (= Y253), F415 (= F414), Q419 (≠ N418)
Sites not aligning to the query:
Q9ET37 Solute carrier family 5 member 4A; SGLT3-a from Mus musculus (Mouse) (see paper)
29% identity, 89% coverage: 3:492/550 of query aligns to 25:540/656 of Q9ET37
- E457 (≠ N418) mutation to Q: Confers sodium-dependent sugar transport activity not found in the wild type protein.
7ynjA Structure of human sglt2-map17 complex bound with substrate amg in the occluded conformation (see paper)
31% identity, 80% coverage: 7:446/550 of query aligns to 1:443/564 of 7ynjA
Sites not aligning to the query:
3dh4A Crystal structure of sodium/sugar symporter with bound galactose from vibrio parahaemolyticus (see paper)
36% identity, 73% coverage: 43:446/550 of query aligns to 19:421/512 of 3dh4A
Q9Y289 Sodium-dependent multivitamin transporter; Na(+)-dependent multivitamin transporter; hSMVT; Solute carrier family 5 member 6 from Homo sapiens (Human) (see 10 papers)
24% identity, 79% coverage: 20:456/550 of query aligns to 42:466/635 of Q9Y289
- C68 (≠ W48) mutation to A: No effect on biotin transport.
- T78 (= T58) mutation to A: Reduced membrane localization. Decrease in biotin transport.
- C104 (≠ W84) mutation to A: No effect on biotin transport.
- R123 (= R103) to L: in SMVTD; reduced membrane localization; impaired biotin transport
- S128 (≠ T108) mutation to A: No effect on biotin transport.
- N138 (= N118) mutation to A: Reduced protein levels. Decrease in biotin transport.
- C144 (≠ L125) mutation to A: No effect on biotin transport.
- Y162 (≠ L143) to C: in COMNB; no effect on membrane localization
- C187 (≠ T168) mutation to A: No effect on biotin transport.
- S242 (≠ D223) mutation to A: No effect on biotin transport.
- S283 (≠ G266) mutation to A: No effect on protein levels or membrane localization.
- T286 (≠ D269) mutation to A: Resistant to phorbol 12-myristate 13-acetate (PMA)-induced inhibition of biotin transport. No effect on protein levels or membrane localization.
- C294 (≠ S277) mutation to A: Reduced membrane localization. Decrease in biotin transport (decreased Vmax, no change in Km).; mutation C->S,M: Decrease in biotin transport.
- C309 (≠ V292) mutation to A: No effect on biotin transport.
- C358 (≠ A348) mutation to A: No effect on biotin transport.
- T366 (≠ Q356) mutation to A: No effect on biotin transport.
- R400 (= R390) to T: in SMVTD; impaired biotin transport; dbSNP:rs370950187
- C410 (≠ P405) mutation to A: No effect on biotin transport.
- S429 (≠ D419) to G: in COMNB; no effect on membrane localization
- C443 (≠ L433) mutation to A: No effect on biotin transport.
- C450 (≠ K440) mutation to A: No effect on biotin transport.
Sites not aligning to the query:
- 94:635 natural variant: Missing (in SMVTD and COMNB; reduced membrane localization; impaired biotin transport; dbSNP:rs994218778)
- 481 S → F: in dbSNP:rs1395
- 489 N→A: Slight decrease in protein levels. Decrease in biotin transport.
- 498 N→A: No effect on biotin transport.
- 534 N→A: No effect on biotin transport.
- 567:635 mutation Missing: Loss of biotin transport. Loss of membrane localization.
- 570:635 mutation Missing: Loss of biotin transport. Loss of membrane localization.
- 575:635 mutation Missing: Partial loss (75%) of biotine transport. Apical membrane localization and intracellular structure localization in polarized cells.
- 577 C→A: No effect on biotin transport.
- 583 C→A: No effect on biotin transport.
- 584:635 mutation Missing: Partial loss (75%) of biotine transport. Apical membrane localization and intracellular structure localization in polarized cells.
- 600:635 mutation Missing: Partial loss (75%) of biotine transport. Apical membrane localization and intracellular structure localization in polarized cells.
- 612:635 mutation Missing: Partial loss (75%) of biotine transport. Apical membrane localization and intracellular structure localization in polarized cells.
- 616:635 mutation Missing: Loss of apical membrane localization in polarized cells. Basolateral localization in polarized cells.
- 620:635 mutation Missing: Partial loss (25%) of biotine transport. No change in apical membrane localization in polarized cells.
- 624:635 mutation Missing: Partial loss (25%) of biotine transport. No change in apical membrane localization in polarized cells.
- 627 T→A: No effect on biotin transport.
- 628 mutation C->A,S: Decrease in biotin transport.
- 632:635 mutation Missing: Partial loss (25%) of biotine transport. No change in apical membrane localization in polarized cells.
Q92911 Sodium/iodide cotransporter; Na(+)/I(-) cotransporter; Natrium iodide transporter; Sodium-iodide symporter; Na(+)/I(-) symporter; Solute carrier family 5 member 5 from Homo sapiens (Human) (see 3 papers)
24% identity, 79% coverage: 12:445/550 of query aligns to 21:444/643 of Q92911
- A102 (= A94) natural variant: A -> P
- H226 (≠ E219) mutation H->A,D,E,K: Significant loss of iodide transport activity but no effect on its localization to the cell membrane.
- D237 (≠ G232) mutation to A: Loss of localization to the cell membrane, significant loss of iodide transport activity but no effect on homodimerization.
- Y242 (≠ M237) Required for homodimerization; mutation to A: Loss of localization to the cell membrane, significant loss of iodide transport activity but no effect on homodimerization. Reduced homodimerization; when associated with A-471. Loss of iodide transport activity; when associated with F-535.
- T243 (≠ S238) Required for homodimerization; mutation to A: Loss of localization to the cell membrane, significant loss of iodide transport activity but no effect on homodimerization. Reduced homodimerization; when associated with A-471.
Sites not aligning to the query:
- 471 Required for homodimerization; Q→A: No effect on localization to the cell membrane, iodide transport activity and homodimerization. Significant loss of homodimerization; when associated with A-242 or A243.
- 525 A→F: Loss of localization to the cell membrane, significant loss of iodide transport activity but no effect on homodimerization. Loss of iodide transport activity; when associated with A-242.
- 536 T → Q: requires 2 nucleotide substitutions
- 556 S → Q: requires 2 nucleotide substitutions
Q8N695 Sodium-coupled monocarboxylate transporter 1; Apical iodide transporter; Electrogenic sodium monocarboxylate cotransporter; Sodium iodide-related cotransporter; Solute carrier family 5 member 8 from Homo sapiens (Human) (see 3 papers)
22% identity, 79% coverage: 33:467/550 of query aligns to 39:463/610 of Q8N695
- V193 (≠ S188) to I: in dbSNP:rs1709189
- F251 (≠ W252) to V: in dbSNP:rs11834933
Sites not aligning to the query:
- 608 T→A: Loss of interaction with PDZK1.
- 608:610 PDZ-binding
- 610 L→A: Loss of interaction with PDZK1.
Query Sequence
>CA265_RS04220 FitnessBrowser__Pedo557:CA265_RS04220
MISTTDIVITIAYILFIVTIGLWTGTRKKKNEETTSGEYFLAGKTLKWPMIGLALFATNI
SCLHLVSLAQSGFDSGLLNGNFEWMAAFTLILLALLFIPFYIRSGISTLPDFLERRYNRA
CRDWLAFISILSAIIIHIAFSFLAGGIVLETLFGIDMYVSIVVIALLTGLYTIIGGLRAV
VVTETIQSLVLITGAIIITYFAWNKVGGWDHMTAILQKENAMDKLSMIRPIGDKSGMSWI
AVFLGYPVLGIWYWCADQTIVQRVLGAKDENHARVGSLFCGFIKILPVFIFVLPGLFAYI
LYKSGTMDLSSLQTVGSNGETVLNTKGIYTLMITQLLPKGLVGILVAALLSGLMSQIAGA
LNSIATLSSYDLYKRFKPETSDKKLVSVGRWSAGIALTVSIGLLPLLNSYESLFNGINDV
IAHIAPPITCVFLLGVFWKKASAKGAQYTLLLGSIIGAGVFVVNKVYGTETIIGQIPFMM
MAFYLFCICVLIQVVFSHIYPVKHTAQSETLYWTSIWEPLKSKGWSGIGNYKFLSVLLLA
IMGVLYVYFK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory