SitesBLAST
Comparing CA265_RS04230 FitnessBrowser__Pedo557:CA265_RS04230 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5o43A 17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with a non-steroidal 2,6-pyridinketone inhibitor. (see paper)
38% identity, 91% coverage: 24:255/256 of query aligns to 24:253/253 of 5o43A
- active site: S138 (= S139), Y151 (= Y152), K155 (= K156)
- binding 2-fluoranyl-3-[6-[(4-fluoranyl-3-oxidanyl-phenyl)-methyl-amino]pyridin-2-yl]phenol: H90 (≠ A91), S138 (= S139), Q145 (= Q146), A146 (≠ D147), Q147 (≠ N148), Y151 (= Y152), N183 (≠ A184), W189 (≠ L190), L192 (≠ W193)
- binding beta-D-glucopyranose: W185 (≠ N186), T186 (= T187), P187 (= P188), E190 (≠ Q191)
- binding nicotinamide-adenine-dinucleotide: D37 (= D37), K38 (= K38), D59 (≠ N60), V60 (≠ L61), N86 (= N87), L110 (≠ V111), Y151 (= Y152), K155 (= K156), P181 (= P182), G182 (≠ A183), N183 (≠ A184), I184 (= I185), T186 (= T187), L188 (≠ T189)
Sites not aligning to the query:
5en4A Complex of 17-beta-hydroxysteroid dehydrogenase type 14 with inhibitor. (see paper)
38% identity, 89% coverage: 24:252/256 of query aligns to 24:250/251 of 5en4A
- active site: S138 (= S139), A148 (≠ H149), Y151 (= Y152), K155 (= K156)
- binding [2,3-bis(oxidanyl)phenyl]-[6-(2-fluoranyl-3-oxidanyl-phenyl)pyridin-2-yl]methanone: H90 (≠ A91), S138 (= S139), Q145 (= Q146), A146 (≠ D147), Q147 (≠ N148), Y151 (= Y152), N183 (≠ A184), W189 (≠ L190), L192 (≠ W193)
- binding nicotinamide-adenine-dinucleotide: D37 (= D37), K38 (= K38), D59 (≠ N60), V60 (≠ L61), N86 (= N87), L110 (≠ V111), S138 (= S139), Y151 (= Y152), K155 (= K156), P181 (= P182), G182 (≠ A183), I184 (= I185), T186 (= T187), L188 (≠ T189)
Sites not aligning to the query:
5o6xA 17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with a non-steroidal quinoline based inhibitor (see paper)
38% identity, 89% coverage: 24:252/256 of query aligns to 23:249/253 of 5o6xA
- active site: S137 (= S139), Y150 (= Y152), K154 (= K156)
- binding (4-fluoranyl-3-oxidanyl-phenyl)-(6-methylquinolin-2-yl)methanone: H89 (≠ A91), S137 (= S139), L138 (≠ M140), V139 (= V141), Q144 (= Q146), G181 (≠ A183), N182 (≠ A184), W188 (≠ L190), L191 (≠ W193)
- binding beta-D-glucopyranose: W184 (≠ N186), T185 (= T187), P186 (= P188), E189 (≠ Q191)
- binding nicotinamide-adenine-dinucleotide: D36 (= D37), K37 (= K38), D58 (≠ N60), V59 (≠ L61), N85 (= N87), G87 (= G89), L109 (≠ V111), S137 (= S139), Y150 (= Y152), K154 (= K156), P180 (= P182), G181 (≠ A183), I183 (= I185), T185 (= T187), L187 (≠ T189)
Sites not aligning to the query:
5hs6A Human 17beta-hydroxysteroid dehydrogenase type 14 in complex with estrone (see paper)
38% identity, 89% coverage: 24:252/256 of query aligns to 24:250/257 of 5hs6A
- active site: S138 (= S139), A148 (≠ H149), Y151 (= Y152), K155 (= K156)
- binding (9beta,13alpha)-3-hydroxyestra-1,3,5(10)-trien-17-one: H90 (≠ A91), Q145 (= Q146), Y151 (= Y152), L192 (≠ W193)
- binding nicotinamide-adenine-dinucleotide: D37 (= D37), K38 (= K38), D59 (≠ N60), N86 (= N87), L110 (≠ V111), S138 (= S139), Y151 (= Y152), K155 (= K156), P181 (= P182), G182 (≠ A183), N183 (≠ A184), I184 (= I185), T186 (= T187), L188 (≠ T189)
Sites not aligning to the query:
5o6oA 17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with a non-steroidal 2,6-pyridinketone inhibitor (see paper)
38% identity, 89% coverage: 24:252/256 of query aligns to 24:250/256 of 5o6oA
- active site: S138 (= S139), Y151 (= Y152), K155 (= K156)
- binding 2-fluoranyl-3-[6-(4-fluoranyl-3-oxidanyl-phenoxy)pyridin-2-yl]phenol: H90 (≠ A91), S138 (= S139), Q145 (= Q146), A146 (≠ D147), Q147 (≠ N148), Y151 (= Y152), N183 (≠ A184), W189 (≠ L190), L192 (≠ W193)
- binding beta-D-glucopyranose: W185 (≠ N186), T186 (= T187), P187 (= P188), E190 (≠ Q191)
- binding nicotinamide-adenine-dinucleotide: D37 (= D37), K38 (= K38), D59 (≠ N60), V60 (≠ L61), N86 (= N87), L110 (≠ V111), S138 (= S139), Y151 (= Y152), K155 (= K156), P181 (= P182), G182 (≠ A183), N183 (≠ A184), I184 (= I185), T186 (= T187), L188 (≠ T189)
Sites not aligning to the query:
5o42A 17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with a non-steroidal 2,6-pyridinketone inhibitor. (see paper)
38% identity, 89% coverage: 24:252/256 of query aligns to 24:250/256 of 5o42A
- active site: S138 (= S139), Y151 (= Y152), K155 (= K156)
- binding 2-fluoranyl-3-[6-[1-(4-fluoranyl-3-oxidanyl-phenyl)ethenyl]pyridin-2-yl]phenol: H90 (≠ A91), P93 (≠ S94), S138 (= S139), Q145 (= Q146), A146 (≠ D147), Y151 (= Y152), N183 (≠ A184), W189 (≠ L190), L192 (≠ W193)
- binding beta-D-glucopyranose: W185 (≠ N186), T186 (= T187), P187 (= P188), E190 (≠ Q191)
- binding nicotinamide-adenine-dinucleotide: D37 (= D37), K38 (= K38), D59 (≠ N60), V60 (≠ L61), N86 (= N87), G88 (= G89), L110 (≠ V111), S138 (= S139), Y151 (= Y152), K155 (= K156), P181 (= P182), G182 (≠ A183), N183 (≠ A184), I184 (= I185), T186 (= T187), L188 (≠ T189)
Sites not aligning to the query:
5icmA 17beta-hydroxysteroid dehydrogenase type 14 in complex with a non- steroidal inhibitor (see paper)
38% identity, 89% coverage: 24:252/256 of query aligns to 23:249/255 of 5icmA
- active site: S137 (= S139), A147 (≠ H149), Y150 (= Y152), K154 (= K156)
- binding [6-(3,4-dihydroxyphenyl)pyridin-2-yl](4-fluoro-3-hydroxyphenyl)methanone: H89 (≠ A91), P92 (≠ S94), S137 (= S139), Q144 (= Q146), A145 (≠ D147), Q146 (≠ N148), Y150 (= Y152), N182 (≠ A184), W188 (≠ L190), L191 (≠ W193)
- binding alpha-D-glucopyranose: W184 (≠ N186), T185 (= T187), P186 (= P188), E189 (≠ Q191)
- binding nicotinamide-adenine-dinucleotide: D36 (= D37), K37 (= K38), D58 (≠ N60), V59 (≠ L61), N85 (= N87), L109 (≠ V111), S137 (= S139), Y150 (= Y152), K154 (= K156), P180 (= P182), G181 (≠ A183), N182 (≠ A184), I183 (= I185), T185 (= T187), L187 (≠ T189)
Sites not aligning to the query:
6gtbA 17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with fb211
38% identity, 89% coverage: 24:252/256 of query aligns to 24:250/257 of 6gtbA
- active site: S138 (= S139), Y151 (= Y152), K155 (= K156)
- binding beta-D-glucopyranose: W185 (≠ N186), T186 (= T187), P187 (= P188), E190 (≠ Q191)
- binding 3-[6-(3-hydroxyphenyl)pyridin-2-yl]benzoic acid: H90 (≠ A91), P93 (≠ S94), S138 (= S139), Q145 (= Q146), A146 (≠ D147), Q147 (≠ N148), Y151 (= Y152), W189 (≠ L190), L192 (≠ W193), M196 (≠ Q197)
- binding nicotinamide-adenine-dinucleotide: D37 (= D37), K38 (= K38), D59 (≠ N60), V60 (≠ L61), N86 (= N87), L110 (≠ V111), S138 (= S139), Y151 (= Y152), K155 (= K156), P181 (= P182), G182 (≠ A183), N183 (≠ A184), I184 (= I185), T186 (= T187), L188 (≠ T189)
Sites not aligning to the query:
5o7cA 17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with a non-steroidal quinoline based inhibitor (see paper)
38% identity, 89% coverage: 24:252/256 of query aligns to 24:250/257 of 5o7cA
- active site: S138 (= S139), Y151 (= Y152), K155 (= K156)
- binding 2-(4-fluoranyl-3-oxidanyl-phenyl)carbonylquinoline-7-carbonitrile: H90 (≠ A91), P93 (≠ S94), S138 (= S139), Y151 (= Y152), N183 (≠ A184), W189 (≠ L190), L192 (≠ W193), T202 (≠ I203)
- binding beta-D-glucopyranose: W185 (≠ N186), T186 (= T187), P187 (= P188), E190 (≠ Q191)
- binding nicotinamide-adenine-dinucleotide: D37 (= D37), K38 (= K38), D59 (≠ N60), V60 (≠ L61), N86 (= N87), A87 (= A88), L110 (≠ V111), S138 (= S139), Y151 (= Y152), K155 (= K156), P181 (= P182), G182 (≠ A183), N183 (≠ A184), I184 (= I185), T186 (= T187), L188 (≠ T189)
Sites not aligning to the query:
5o72A 17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with a non-steroidal quinoline based inhibitor (see paper)
38% identity, 89% coverage: 24:252/256 of query aligns to 23:249/255 of 5o72A
- active site: S137 (= S139), Y150 (= Y152), K154 (= K156)
- binding 2-azanyl-~{N}-[2-(4-fluoranyl-3-oxidanyl-phenyl)carbonylquinolin-7-yl]ethanamide: H89 (≠ A91), S137 (= S139), Y150 (= Y152), N182 (≠ A184), W188 (≠ L190), L191 (≠ W193)
- binding nicotinamide-adenine-dinucleotide: D36 (= D37), K37 (= K38), D58 (≠ N60), V59 (≠ L61), N85 (= N87), L109 (≠ V111), Y150 (= Y152), K154 (= K156), P180 (= P182), G181 (≠ A183), N182 (≠ A184), I183 (= I185), T185 (= T187), L187 (≠ T189)
Sites not aligning to the query:
5o6zA 17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with a non-steroidal quinoline based inhibitor (see paper)
38% identity, 89% coverage: 24:252/256 of query aligns to 24:250/257 of 5o6zA
- active site: S138 (= S139), Y151 (= Y152), K155 (= K156)
- binding (4-fluoranyl-3-oxidanyl-phenyl)-quinolin-2-yl-methanone: H90 (≠ A91), S138 (= S139), Y151 (= Y152), N183 (≠ A184), W189 (≠ L190), L192 (≠ W193)
- binding beta-D-glucopyranose: W185 (≠ N186), T186 (= T187), P187 (= P188), E190 (≠ Q191)
- binding nicotinamide-adenine-dinucleotide: D37 (= D37), K38 (= K38), D59 (≠ N60), V60 (≠ L61), N86 (= N87), L110 (≠ V111), S138 (= S139), Y151 (= Y152), K155 (= K156), P181 (= P182), G182 (≠ A183), I184 (= I185), T186 (= T187), L188 (≠ T189)
Sites not aligning to the query:
5l7yA 17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with a non-steroidal inhibitor. (see paper)
38% identity, 89% coverage: 24:252/256 of query aligns to 24:250/256 of 5l7yA
- active site: S138 (= S139), A148 (≠ H149), Y151 (= Y152), K155 (= K156)
- binding (4-fluoranyl-3-oxidanyl-phenyl)-[6-(2-fluoranyl-3-oxidanyl-phenyl)pyridin-2-yl]methanone: R24 (≠ K24), G42 (≠ A42), A45 (≠ K45), H90 (≠ A91), S138 (= S139), Q145 (= Q146), A146 (≠ D147), Y151 (= Y152), N183 (≠ A184), W189 (≠ L190), L192 (≠ W193)
- binding nicotinamide-adenine-dinucleotide: D37 (= D37), K38 (= K38), D59 (≠ N60), V60 (≠ L61), N86 (= N87), L110 (≠ V111), I136 (≠ T137), Y151 (= Y152), K155 (= K156), P181 (= P182), G182 (≠ A183), I184 (= I185), T186 (= T187), L188 (≠ T189)
Sites not aligning to the query:
5l7tA 17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with a non-steroidal inhibitor. (see paper)
38% identity, 89% coverage: 24:252/256 of query aligns to 24:250/256 of 5l7tA
- active site: S138 (= S139), A148 (≠ H149), Y151 (= Y152), K155 (= K156)
- binding (4-fluoranyl-3-oxidanyl-phenyl)-[6-(3-methyl-4-oxidanyl-phenyl)pyridin-2-yl]methanone: H90 (≠ A91), S138 (= S139), Q145 (= Q146), A146 (≠ D147), Y151 (= Y152), N183 (≠ A184), W189 (≠ L190), L192 (≠ W193)
- binding nicotinamide-adenine-dinucleotide: D37 (= D37), K38 (= K38), D59 (≠ N60), V60 (≠ L61), N86 (= N87), A87 (= A88), G88 (= G89), L110 (≠ V111), S138 (= S139), Y151 (= Y152), K155 (= K156), P181 (= P182), G182 (≠ A183), N183 (≠ A184), I184 (= I185), T186 (= T187), L188 (≠ T189)
Sites not aligning to the query:
5l7wA 17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with a non-steroidal inhibitor. (see paper)
38% identity, 89% coverage: 24:252/256 of query aligns to 24:250/254 of 5l7wA
- active site: S138 (= S139), A148 (≠ H149), Y151 (= Y152), K155 (= K156)
- binding [4-fluoranyl-2,3-bis(oxidanyl)phenyl]-[6-(2-fluoranyl-3-oxidanyl-phenyl)pyridin-2-yl]methanone: H90 (≠ A91), S138 (= S139), Q145 (= Q146), A146 (≠ D147), Q147 (≠ N148), Y151 (= Y152), N183 (≠ A184), W189 (≠ L190), L192 (≠ W193)
- binding beta-D-glucopyranose: W185 (≠ N186), T186 (= T187), P187 (= P188), E190 (≠ Q191)
- binding nicotinamide-adenine-dinucleotide: D37 (= D37), K38 (= K38), D59 (≠ N60), V60 (≠ L61), N86 (= N87), A87 (= A88), G88 (= G89), L110 (≠ V111), S138 (= S139), Y151 (= Y152), K155 (= K156), P181 (= P182), G182 (≠ A183), N183 (≠ A184), I184 (= I185), T186 (= T187), L188 (≠ T189)
Sites not aligning to the query:
6gtuA 17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with fragment j6
38% identity, 89% coverage: 24:252/256 of query aligns to 24:250/268 of 6gtuA
- active site: S138 (= S139), Y151 (= Y152), K155 (= K156)
- binding N-(1,3-benzodioxol-5-ylmethyl)cyclopentanamine: N183 (≠ A184)
- binding nicotinamide-adenine-dinucleotide: D37 (= D37), K38 (= K38), D59 (≠ N60), N86 (= N87), A87 (= A88), G88 (= G89), L110 (≠ V111), S138 (= S139), Y151 (= Y152), K155 (= K156), G182 (≠ A183), I184 (= I185), T186 (= T187), L188 (≠ T189)
Sites not aligning to the query:
6emmA 17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with salicylic acid
38% identity, 89% coverage: 24:252/256 of query aligns to 24:250/268 of 6emmA
- active site: S138 (= S139), Y151 (= Y152), K155 (= K156)
- binding nicotinamide-adenine-dinucleotide: D37 (= D37), K38 (= K38), D59 (≠ N60), N86 (= N87), A87 (= A88), G88 (= G89), L110 (≠ V111), S138 (= S139), Y151 (= Y152), K155 (= K156), P181 (= P182), G182 (≠ A183), I184 (= I185), T186 (= T187), L188 (≠ T189)
Sites not aligning to the query:
6qckA 17beta-hydroxysteroid dehydrogenase 14 variant t205 in complex with fb262 (see paper)
38% identity, 89% coverage: 24:252/256 of query aligns to 24:250/258 of 6qckA
- active site: S138 (= S139), Y151 (= Y152), K155 (= K156)
- binding beta-D-glucopyranose: W185 (≠ N186), T186 (= T187), P187 (= P188), E190 (≠ Q191)
- binding 2-[2-(1,3-benzodioxol-2-yl)ethyl]benzoic acid: H90 (≠ A91), P93 (≠ S94), S138 (= S139), Q145 (= Q146), Y151 (= Y152), L188 (≠ T189), W189 (≠ L190), L192 (≠ W193)
- binding nicotinamide-adenine-dinucleotide: D37 (= D37), K38 (= K38), D59 (≠ N60), V60 (≠ L61), N86 (= N87), L110 (≠ V111), S138 (= S139), Y151 (= Y152), K155 (= K156), P181 (= P182), G182 (≠ A183), N183 (≠ A184), I184 (= I185), T186 (= T187), L188 (≠ T189)
Sites not aligning to the query:
6zt2A 17beta-hydroxysteroid dehydrogenase type 14 variant s205 in complex with 3-chloro-2,6-difluorophenol
38% identity, 89% coverage: 24:252/256 of query aligns to 23:249/252 of 6zt2A
- binding beta-D-glucopyranose: W184 (≠ N186), T185 (= T187), P186 (= P188), E189 (≠ Q191)
- binding nicotinamide-adenine-dinucleotide: D36 (= D37), K37 (= K38), D58 (≠ N60), V59 (≠ L61), N85 (= N87), L109 (≠ V111), S137 (= S139), Y150 (= Y152), K154 (= K156), P180 (= P182), G181 (≠ A183), N182 (≠ A184), I183 (= I185), T185 (= T187), L187 (≠ T189)
- binding 3-chloranyl-2,6-bis(fluoranyl)phenol: H89 (≠ A91), S137 (= S139), Y150 (= Y152), N182 (≠ A184), W188 (≠ L190)
Sites not aligning to the query:
6zdiA 17beta-hydroxysteroid dehydrogenase type 14 variant s205 in complex with 2-fluoro-5-nitrophenol
38% identity, 89% coverage: 24:252/256 of query aligns to 23:249/252 of 6zdiA
- active site: S137 (= S139), Y150 (= Y152), K154 (= K156)
- binding nicotinamide-adenine-dinucleotide: D36 (= D37), K37 (= K38), D58 (≠ N60), V59 (≠ L61), N85 (= N87), A86 (= A88), L109 (≠ V111), I135 (≠ T137), S137 (= S139), Y150 (= Y152), K154 (= K156), P180 (= P182), G181 (≠ A183), N182 (≠ A184), I183 (= I185), T185 (= T187), L187 (≠ T189)
- binding 2-fluoranyl-5-nitro-phenol: H89 (≠ A91), S137 (= S139), Y150 (= Y152), L187 (≠ T189), W188 (≠ L190), L191 (≠ W193)
Sites not aligning to the query:
6zdeA 17beta-hydroxysteroid dehydrogenase type 14 variant s205 in complex with pentafluorophenol
38% identity, 89% coverage: 24:252/256 of query aligns to 23:249/252 of 6zdeA
- active site: S137 (= S139), Y150 (= Y152), K154 (= K156)
- binding nicotinamide-adenine-dinucleotide: D36 (= D37), K37 (= K38), D58 (≠ N60), V59 (≠ L61), N85 (= N87), L109 (≠ V111), S137 (= S139), Y150 (= Y152), K154 (= K156), P180 (= P182), G181 (≠ A183), N182 (≠ A184), I183 (= I185), T185 (= T187), L187 (≠ T189)
- binding 2,3,4,5,6-pentakis(fluoranyl)phenol: H89 (≠ A91), S137 (= S139), Y150 (= Y152), L187 (≠ T189), W188 (≠ L190)
Sites not aligning to the query:
Query Sequence
>CA265_RS04230 FitnessBrowser__Pedo557:CA265_RS04230
MNMLHHKIIILTGGADGIGWECAKAYSKAGATVCILDKNPIAESKLNELETAQKIAITCN
LVNENEVAAAFETIIQKFGNIDAIHNNAGIAHPSKTLDQTTDAEWDLLMNVNLKSILYTT
RYGIEQLKKTKGCILNTSSMVGTIGQDNHAAYVATKGAINALTKAMALDYAPYQIRVNAV
SPAAINTPTLQLWSKEQPNKEEIQHYLDKLQPLGGMPAGDVIADACLFLLSDAARFITGT
ILPVSGGAELGYRTII
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory