SitesBLAST
Comparing CA265_RS04615 FitnessBrowser__Pedo557:CA265_RS04615 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9KNV2 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
34% identity, 76% coverage: 81:376/387 of query aligns to 65:356/361 of Q9KNV2
Sites not aligning to the query:
5eksA Structure of 3-dehydroquinate synthase from acinetobacter baumannii in complex with NAD
35% identity, 77% coverage: 83:381/387 of query aligns to 68:353/355 of 5eksA
- active site: R120 (= R136), K142 (= K158), E184 (= E200), K226 (≠ L243), R237 (≠ N254), N241 (≠ D261), H244 (= H264), H248 (= H268), H261 (= H280)
- binding magnesium ion: E184 (= E200), H244 (= H264), H261 (= H280)
- binding nicotinamide-adenine-dinucleotide: D71 (≠ G86), E73 (= E88), K76 (= K91), G104 (= G120), G105 (= G121), V106 (≠ A122), D109 (= D125), T129 (≠ S145), T130 (= T146), D136 (= D152), S137 (= S153), K142 (= K158), T172 (= T188), L173 (= L189), E177 (≠ D193)
Sites not aligning to the query:
3okfA 2.5 angstrom resolution crystal structure of 3-dehydroquinate synthase (arob) from vibrio cholerae
34% identity, 76% coverage: 81:376/387 of query aligns to 66:355/360 of 3okfA
- active site: R120 (= R136), K142 (= K158), E184 (= E200), K226 (≠ H242), R238 (≠ A257), N242 (≠ D261), H245 (= H264), H249 (= H268), H262 (= H280)
- binding nicotinamide-adenine-dinucleotide: D71 (≠ G86), E73 (= E88), K76 (= K91), G104 (= G120), G105 (= G121), V106 (≠ A122), D109 (= D125), T129 (≠ S145), T130 (= T146), L132 (= L148), D136 (= D152), T172 (= T188), L173 (= L189), E177 (≠ D193)
Sites not aligning to the query:
3zokA Structure of 3-dehydroquinate synthase from actinidia chinensis in complex with NAD (see paper)
36% identity, 74% coverage: 44:329/387 of query aligns to 35:315/365 of 3zokA
- active site: R122 (= R136), K144 (= K158), E186 (= E200), K228 (≠ H242), E238 (= E253), R242 (≠ A257), N246 (≠ D261), H249 (= H264), H253 (= H268), H266 (= H280)
- binding glycine: K144 (= K158), K228 (≠ H242), R242 (≠ A257)
- binding nicotinamide-adenine-dinucleotide: T44 (≠ G53), V45 (= V54), D73 (≠ G86), E75 (= E88), K78 (= K91), G106 (= G120), G107 (= G121), V108 (≠ A122), D111 (= D125), T131 (≠ S145), T132 (= T146), M134 (≠ L148), D138 (= D152), S139 (= S153), K144 (= K158), K153 (= K167), T174 (= T188), L175 (= L189), E179 (≠ D193), H266 (= H280)
U3KRF2 3-dehydroquinate synthase, chloroplastic; EC 4.2.3.4 from Actinidia chinensis var. chinensis (Chinese soft-hair kiwi) (see paper)
36% identity, 74% coverage: 44:329/387 of query aligns to 115:395/445 of U3KRF2
6llaB Crystal structure of providencia alcalifaciens 3-dehydroquinate synthase (dhqs) in complex with mg2+ and NAD (see paper)
35% identity, 76% coverage: 80:374/387 of query aligns to 66:357/363 of 6llaB
- active site: R121 (= R136), K143 (= K158), E185 (= E200), K227 (≠ H242), E237 (≠ F252), R242 (≠ A257), N246 (≠ D261), H249 (= H264), H253 (= H268), H266 (= H280)
- binding magnesium ion: E185 (= E200), H249 (= H264), H266 (= H280)
- binding nicotinamide-adenine-dinucleotide: D72 (≠ G86), E74 (= E88), K77 (= K91), G105 (= G120), G106 (= G121), V107 (≠ A122), D110 (= D125), T130 (≠ S145), T131 (= T146), L133 (= L148), D137 (= D152), K143 (= K158), T173 (= T188), L174 (= L189), E178 (≠ D193)
Sites not aligning to the query:
6lk2A Crystal structure of providencia alcalifaciens 3-dehydroquinate synthase (dhqs) in complex with mg2+, NAD and chlorogenic acid (see paper)
35% identity, 76% coverage: 80:374/387 of query aligns to 66:353/357 of 6lk2A
- active site: R121 (= R136), K143 (= K158), E185 (= E200), K227 (≠ H242), R238 (≠ A257), N242 (≠ D261), H245 (= H264), H249 (= H268), H262 (= H280)
- binding (1R,3R,4S,5R)-3-[3-[3,4-bis(oxidanyl)phenyl]propanoyloxy]-1,4,5-tris(oxidanyl)cyclohexane-1-carboxylic acid: D137 (= D152), E185 (= E200), K227 (≠ H242), R238 (≠ A257), N242 (≠ D261), H245 (= H264), T246 (≠ W265), H249 (= H268), H262 (= H280)
- binding magnesium ion: E185 (= E200), H245 (= H264), H262 (= H280)
- binding nicotinamide-adenine-dinucleotide: D72 (≠ G86), E74 (= E88), K77 (= K91), G105 (= G120), G106 (= G121), V107 (≠ A122), D110 (= D125), T130 (≠ S145), T131 (= T146), L133 (= L148), D137 (= D152), S138 (= S153), C170 (≠ F185), T173 (= T188), L174 (= L189), P175 (≠ S190), E178 (≠ D193)
Sites not aligning to the query:
4p53A Vala (2-epi-5-epi-valiolone synthase) from streptomyces hygroscopicus subsp. Jinggangensis 5008 with NAD+ and zn2+ bound (see paper)
32% identity, 74% coverage: 38:324/387 of query aligns to 22:306/360 of 4p53A
- active site: R117 (= R136), K139 (= K158), E181 (= E200), M225 (≠ H242), E235 (= E253), R239 (≠ A257), D243 (= D261), H246 (= H264), P250 (≠ H268), H262 (= H280)
- binding 1,4-dihydronicotinamide adenine dinucleotide: D38 (= D51), T40 (≠ G53), V41 (= V54), L44 (≠ A57), E69 (= E88), K72 (= K91), G101 (= G120), G102 (= G121), V103 (≠ A122), D106 (= D125), T126 (≠ S145), T127 (= T146), I129 (≠ L148), D133 (= D152), A134 (≠ S153), K148 (= K167), T169 (= T188), L170 (= L189), H174 (≠ D193), H262 (= H280)
- binding zinc ion: E181 (= E200), H246 (= H264), H262 (= H280)
H2K887 2-epi-5-epi-valiolone synthase; EEVS; Sedoheptulose 7-phosphate cyclase; EC 4.2.3.152 from Streptomyces hygroscopicus subsp. jinggangensis (strain 5008) (see paper)
31% identity, 81% coverage: 11:324/387 of query aligns to 33:344/414 of H2K887
Q5NFS1 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
31% identity, 73% coverage: 41:323/387 of query aligns to 32:307/359 of Q5NFS1
5hvnA 3.0 angstrom crystal structure of 3-dehydroquinate synthase (arob) from francisella tularensis in complex with NAD.
31% identity, 82% coverage: 41:359/387 of query aligns to 35:335/354 of 5hvnA
- active site: R123 (= R136), K145 (= K158), E187 (= E200), K228 (≠ H242), R239 (≠ A257), N243 (≠ D261), H246 (= H264), H250 (= H268), H263 (= H280)
- binding nicotinamide-adenine-dinucleotide: N45 (≠ D51), L51 (≠ A67), D73 (≠ G86), E75 (= E88), K78 (= K91), G107 (= G120), G108 (= G121), V109 (≠ A122), D112 (= D125), T132 (≠ S145), T133 (= T146), L135 (= L148), D139 (= D152), K145 (= K158), F172 (= F185), T175 (= T188), L176 (= L189), E180 (≠ D193)
P56081 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
31% identity, 75% coverage: 39:329/387 of query aligns to 21:297/343 of P56081
3clhA Crystal structure of 3-dehydroquinate synthase (dhqs)from helicobacter pylori (see paper)
32% identity, 72% coverage: 39:316/387 of query aligns to 18:272/308 of 3clhA
- active site: R107 (= R136), K129 (= K158), E171 (= E200), K207 (≠ H242), R212 (= R247), N216 (≠ D261), H219 (= H264), H223 (= H268), H236 (= H280)
- binding nicotinamide-adenine-dinucleotide: I33 (≠ G53), V34 (= V54), H38 (= H58), S58 (≠ G86), E60 (= E88), K63 (= K91), G91 (= G120), G92 (= G121), V93 (≠ A122), D96 (= D125), T116 (≠ S145), T117 (= T146), L119 (= L148), D123 (= D152), A124 (≠ S153), K129 (= K158), N139 (= N168), T159 (= T188), L160 (= L189), E164 (≠ D193)
Q3M6C3 Demethyl-4-deoxygadusol synthase; DDGS; EC 4.2.3.154 from Trichormus variabilis (strain ATCC 29413 / PCC 7937) (Anabaena variabilis) (see paper)
27% identity, 82% coverage: 11:327/387 of query aligns to 22:334/410 of Q3M6C3
Sites not aligning to the query:
- 347 T→H: No change in activity.
5tprA Desmethyl-4-deoxygadusol synthase from anabaena variabilis (ava_3858) with NAD+ and zn2+ bound (see paper)
27% identity, 82% coverage: 11:327/387 of query aligns to 20:332/400 of 5tprA
- active site: R132 (= R136), K154 (= K158), E196 (= E200), M248 (≠ L243), E258 (= E253), D262 (≠ A257), A266 (≠ D261), H269 (= H264), P273 (≠ H268), H285 (= H280)
- binding nicotinamide-adenine-dinucleotide: D54 (= D51), N56 (= N56), V57 (≠ A57), E85 (≠ P85), K88 (≠ E88), G116 (= G120), G117 (= G121), L118 (≠ A122), D121 (= D125), T141 (≠ S145), T142 (= T146), I144 (≠ L148), D148 (= D152), A149 (≠ S153), K163 (= K167), T184 (= T188), L185 (= L189), Q189 (≠ D193)
- binding zinc ion: E196 (= E200), H269 (= H264), H285 (= H280)
P9WPX9 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
30% identity, 67% coverage: 84:341/387 of query aligns to 71:332/362 of P9WPX9
Sites not aligning to the query:
3qbeA Crystal structure of the 3-dehydroquinate synthase (arob) from mycobacterium tuberculosis
29% identity, 67% coverage: 84:341/387 of query aligns to 66:323/352 of 3qbeA
- active site: R117 (= R136), K139 (= K158), E181 (= E200), K223 (≠ H242), R233 (≠ F252), N237 (≠ D261), H240 (= H264), H244 (= H268), H256 (= H280)
- binding zinc ion: E181 (= E200), H240 (= H264), H256 (= H280)
1xagA Crystal structure of staphlyococcus aureus 3-dehydroquinate synthase (dhqs) in complex with zn2+, NAD+ and carbaphosphonate (see paper)
34% identity, 64% coverage: 82:329/387 of query aligns to 62:300/353 of 1xagA
- active site: R115 (= R136), K136 (= K158), E178 (= E200), K221 (≠ H242), E231 (= E253), R235 (≠ A257), N239 (≠ D261), H242 (= H264), H246 (= H268), H256 (= H280)
- binding [1r-(1alpha,3beta,4alpha,5beta)]-5-(phosphonomethyl)-1,3,4-trihydroxycyclohexane-1-carboxylic acid: K136 (= K158), N146 (= N168), E178 (= E200), K221 (≠ H242), R235 (≠ A257), L238 (= L260), N239 (≠ D261), H242 (= H264), H246 (= H268)
- binding nicotinamide-adenine-dinucleotide: E68 (= E88), K71 (= K91), G99 (= G120), G100 (= G121), A101 (= A122), D104 (= D125), T124 (≠ S145), T125 (= T146), L127 (= L148), D130 (= D152), S131 (= S153), K136 (= K158), K145 (= K167), T166 (= T188), L167 (= L189), Q171 (≠ D193), H256 (= H280)
- binding zinc ion: E178 (= E200), H242 (= H264), H256 (= H280)
Sites not aligning to the query:
Q6GGU4 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Staphylococcus aureus (strain MRSA252) (see paper)
33% identity, 70% coverage: 49:320/387 of query aligns to 37:295/354 of Q6GGU4
6hqvA Pentafunctional arom complex from chaetomium thermophilum (see paper)
28% identity, 72% coverage: 84:362/387 of query aligns to 72:369/1555 of 6hqvA
- active site: R123 (= R136), K145 (= K158), E187 (= E200), K243 (vs. gap), E253 (= E253), R257 (≠ A257), N261 (≠ D261), H264 (= H264), H268 (= H268), H280 (= H280)
- binding glutamic acid: D139 (= D152), K145 (= K158), E187 (= E200), K243 (vs. gap), R257 (≠ A257), H264 (= H264), H280 (= H280)
- binding nicotinamide-adenine-dinucleotide: E76 (= E88), K79 (= K91), G107 (= G120), G108 (= G121), V109 (≠ A122), D112 (= D125), T132 (≠ S145), T133 (= T146), L135 (= L148), D139 (= D152), S140 (= S153), K145 (= K158), K154 (= K167), T175 (= T188), L176 (= L189), P177 (≠ S190), E180 (≠ D193), H280 (= H280)
- binding zinc ion: E187 (= E200), H264 (= H264), H280 (= H280)
Sites not aligning to the query:
- binding (4S,5R)-4,5-dihydroxy-3-oxocyclohex-1-ene-1-carboxylic acid: 1060, 1062, 1181, 1224, 1232, 1242, 1243
- binding nicotinamide-adenine-dinucleotide: 42, 44, 45
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: 413, 562, 563, 874, 923, 924, 979, 1277, 1279, 1323, 1327, 1348, 1368, 1526
Query Sequence
>CA265_RS04615 FitnessBrowser__Pedo557:CA265_RS04615
MEHLHQSFTVQYNYNVFFTSSLFLPENELLNSFLVNLNPAVAVKKILFVIDEGVANAHQD
LNNQIKAYFSKYPQTQLVQDILVIPGGEQVKNDTQYFDRVLEAINVHGIDRHSFVAAIGG
GAVLDMVGYAATVAHRGIKHIRIPSTVLSQNDSGVGVKNGINYFNKKNFLGTFSPPVAVF
NDEVFLSTLSDRDWRSGIAEAIKVALIKDREFFEWLEANATALAQRDITAMNYQIWKCAK
LHLEHIRSADPFENGSARPLDFGHWSAHKLEYLTNFEVRHGEAVAMGIALDAVYSNLSGR
ISTEDAQRVISLIHQLGFELTHPLLQVTEGNSPILQGLEEFREHLGGELTITLLTGLGSG
EEVHEIDADILKQAAEILNNQTAIIQH
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory