SitesBLAST
Comparing CA265_RS04990 FitnessBrowser__Pedo557:CA265_RS04990 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
A0A140FAN3 11-beta-hydroxysteroid dehydrogenase; 17-beta-hydroxysteroid dehydrogenase; Steroleosin; EC 1.1.1.146; EC 1.1.1.62 from Pinus massoniana (Chinese red pine) (see paper)
34% identity, 92% coverage: 2:250/272 of query aligns to 44:292/356 of A0A140FAN3
Sites not aligning to the query:
- 206:356 mutation Missing: Loss of binding to plant derived cholesterol, cholest-5-en-3beta-ol.
Q9P7B4 NADP-dependent 3-hydroxy acid dehydrogenase; L-allo-threonine dehydrogenase; EC 1.1.1.381 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
33% identity, 86% coverage: 3:235/272 of query aligns to 4:238/259 of Q9P7B4
- S42 (≠ V40) modified: Phosphoserine
- T43 (= T41) modified: Phosphothreonine
H9XP47 Meso-2,3-butanediol dehydrogenase; BDH; meso-2,3-BDH; (R,S)-butane-2,3-diol dehydrogenase; NAD(H)-dependent meso-2,3-BDH; SmBdh; EC 1.1.1.- from Serratia marcescens (see paper)
33% identity, 70% coverage: 1:191/272 of query aligns to 1:188/251 of H9XP47
- N15 (≠ S15) binding
- M17 (≠ I17) binding
- D36 (≠ A36) binding
- D60 (= D63) binding
- V61 (= V64) binding
- N87 (= N90) binding
- S138 (= S141) binding ; binding
- V139 (≠ I142) mutation to Q: Retains 50% of activity with acetoin as substrate; when associated with A-247.
- S140 (≠ A143) binding
- Y151 (= Y154) binding ; binding ; binding
- K155 (= K158) binding
- V184 (≠ T187) binding
- T186 (≠ S189) binding
Sites not aligning to the query:
- 197:199 RDK→SEAAGKPLGYGTET: Mimics longer alpha6 helix. Retains 3% of activity with acetoin as substrate.
- 247 Q→A: Retains 10% of activity with acetoin as substrate. Retains 50% of activity with acetoin as substrate; when associated with Q-139.
1edoA The x-ray structure of beta-keto acyl carrier protein reductase from brassica napus complexed with NADP+ (see paper)
36% identity, 68% coverage: 7:191/272 of query aligns to 3:188/244 of 1edoA
- active site: G12 (= G16), S138 (= S141), Y151 (= Y154), K155 (= K158)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G12), S10 (= S14), R11 (≠ S15), I13 (= I17), N31 (≠ L34), Y32 (≠ A35), A33 (= A36), R34 (= R37), S35 (≠ Q38), D59 (= D63), V60 (= V64), N86 (= N90), A87 (= A91), S138 (= S141), Y151 (= Y154), K155 (= K158), P181 (= P184), G182 (= G185), I184 (≠ T187), S186 (= S189), M188 (≠ I191)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
32% identity, 69% coverage: 3:189/272 of query aligns to 5:187/244 of 4nbuB
- active site: G18 (= G16), N111 (= N114), S139 (= S141), Q149 (≠ R151), Y152 (= Y154), K156 (= K158)
- binding acetoacetyl-coenzyme a: D93 (≠ R96), K98 (≠ D101), S139 (= S141), N146 (≠ L148), V147 (≠ P149), Q149 (≠ R151), Y152 (= Y154), F184 (= F186)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G12), N17 (≠ S15), G18 (= G16), I19 (= I17), D38 (≠ T41), F39 (≠ L42), V59 (≠ A62), D60 (= D63), V61 (= V64), N87 (= N90), A88 (= A91), G89 (= G92), I90 (≠ L93), T137 (≠ V139), S139 (= S141), Y152 (= Y154), K156 (= K158), P182 (= P184), F184 (= F186), T185 (= T187), T187 (≠ S189)
Sites not aligning to the query:
P73574 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-acyl carrier protein reductase; EC 1.1.1.100 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
36% identity, 69% coverage: 3:191/272 of query aligns to 4:193/247 of P73574
- A14 (= A13) mutation to G: 4.2-fold increase in activity on acetoacetyl-CoA.
- P151 (= P149) mutation to F: 2.7-fold increase in activity on acetoacetyl-CoA.; mutation to V: 5.7-fold increase in activity on acetoacetyl-CoA.
- K160 (= K158) mutation to A: Almost no activity on acetoacetyl-CoA.
- F188 (= F186) mutation to Y: 3.3-fold increase in activity on acetoacetyl-CoA.
Sites not aligning to the query:
- 198 N→R: 3.5-fold increase in activity on acetoacetyl-CoA.
6vspB Structure of serratia marcescens 2,3-butanediol dehydrogenase mutant q247a (see paper)
33% identity, 69% coverage: 3:191/272 of query aligns to 5:190/252 of 6vspB
6vspA Structure of serratia marcescens 2,3-butanediol dehydrogenase mutant q247a (see paper)
33% identity, 69% coverage: 3:191/272 of query aligns to 3:188/251 of 6vspA
- active site: G16 (= G16), S138 (= S141), Y151 (= Y154)
- binding nicotinamide-adenine-dinucleotide: G12 (= G12), N15 (≠ S15), G16 (= G16), M17 (≠ I17), D36 (≠ A36), W37 (≠ R37), W37 (≠ R37), A38 (≠ Q38), I59 (≠ A62), D60 (= D63), V61 (= V64), N87 (= N90), A88 (= A91), G89 (= G92), V90 (≠ L93), V110 (= V113), T136 (≠ V139), S138 (= S141), Y151 (= Y154), K155 (= K158), P181 (= P184), S182 (≠ G185), L183 (≠ F186), V184 (≠ T187), T186 (≠ S189), N187 (= N190), M188 (≠ I191)
Sites not aligning to the query:
6xewA Structure of serratia marcescens 2,3-butanediol dehydrogenase (see paper)
33% identity, 69% coverage: 3:191/272 of query aligns to 3:188/251 of 6xewA
- active site: G16 (= G16), S138 (= S141), Y151 (= Y154)
- binding r,3-hydroxybutan-2-one: S138 (= S141), S140 (≠ A143), Y151 (= Y154)
- binding s,3-hydroxybutan-2-one: S138 (= S141), Y151 (= Y154), S182 (≠ G185)
- binding nicotinamide-adenine-dinucleotide: G12 (= G12), N15 (≠ S15), G16 (= G16), M17 (≠ I17), D36 (≠ A36), W37 (≠ R37), W37 (≠ R37), A38 (≠ Q38), I59 (≠ A62), D60 (= D63), V61 (= V64), N87 (= N90), A88 (= A91), G89 (= G92), V110 (= V113), T136 (≠ V139), S138 (= S141), Y151 (= Y154), K155 (= K158), S182 (≠ G185), L183 (≠ F186), V184 (≠ T187), T186 (≠ S189), N187 (= N190), M188 (≠ I191)
Sites not aligning to the query:
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
32% identity, 70% coverage: 1:191/272 of query aligns to 1:192/247 of 4jroC
- active site: G16 (= G16), S142 (= S141), Q152 (≠ R151), Y155 (= Y154), K159 (= K158)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G12), S14 (= S14), R15 (≠ S15), G16 (= G16), I17 (= I17), N35 (≠ A35), Y36 (≠ A36), N37 (≠ R37), G38 (≠ Q38), S39 (≠ Y39), N63 (≠ D63), V64 (= V64), N90 (= N90), A91 (= A91), I93 (≠ L93), I113 (≠ V113), S142 (= S141), Y155 (= Y154), K159 (= K158), P185 (= P184), I188 (≠ T187), T190 (≠ S189)
Q05016 NADP-dependent 3-hydroxy acid dehydrogenase; L-allo-threonine dehydrogenase; EC 1.1.1.-; EC 1.1.1.381 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
31% identity, 86% coverage: 3:235/272 of query aligns to 11:248/267 of Q05016
- N102 (= N90) binding
- Y168 (= Y154) binding
- K172 (= K158) binding
3rkuA Substrate fingerprint and the structure of NADP+ dependent serine dehydrogenase from saccharomyces cerevisiae complexed with NADP+
31% identity, 86% coverage: 3:235/272 of query aligns to 12:249/268 of 3rkuA
- active site: A107 (= A97), N128 (= N114), S156 (= S141), Y169 (= Y154), K173 (= K158), N214 (≠ D199)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G21 (= G12), S23 (= S14), G25 (= G16), I26 (= I17), R49 (= R37), R50 (≠ Q38), D76 (= D63), I77 (≠ V64), N103 (= N90), A104 (= A91), G105 (= G92), K106 (≠ R96), S156 (= S141), Y169 (= Y154), K173 (= K158), P199 (= P184), G200 (= G185), V202 (≠ T187), T204 (≠ S189), E205 (≠ N190), F206 (≠ I191)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
32% identity, 68% coverage: 1:186/272 of query aligns to 3:186/255 of 5itvA
- active site: G18 (= G16), S141 (= S141), Y154 (= Y154), K158 (= K158)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G12), S17 (= S15), G18 (= G16), I19 (= I17), D38 (≠ A36), I39 (≠ V40), T61 (≠ A62), I63 (≠ V64), N89 (= N90), G91 (= G92), T139 (≠ V139), S141 (= S141), Y154 (= Y154), K158 (= K158), P184 (= P184), G185 (= G185), I186 (≠ F186)
Sites not aligning to the query:
5itvD Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
32% identity, 68% coverage: 1:186/272 of query aligns to 3:186/227 of 5itvD
- active site: G18 (= G16), S141 (= S141), Y154 (= Y154), K158 (= K158)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G12), S17 (= S15), G18 (= G16), I19 (= I17), D38 (≠ A36), I39 (≠ V40), T61 (≠ A62), D62 (= D63), I63 (≠ V64), N89 (= N90), T139 (≠ V139), S141 (= S141), Y154 (= Y154), K158 (= K158), P184 (= P184), G185 (= G185)
Sites not aligning to the query:
3pk0B Crystal structure of short-chain dehydrogenase/reductase sdr from mycobacterium smegmatis (see paper)
31% identity, 93% coverage: 2:255/272 of query aligns to 7:258/262 of 3pk0B
2jahC Biochemical and structural analysis of the clavulanic acid dehydeogenase (cad) from streptomyces clavuligerus (see paper)
37% identity, 70% coverage: 3:192/272 of query aligns to 4:192/246 of 2jahC
- active site: S141 (= S141), Y154 (= Y154), K158 (= K158)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G13 (= G12), S15 (= S14), S16 (= S15), G17 (= G16), I18 (= I17), A37 (= A36), R38 (= R37), R39 (≠ Q38), D63 (= D63), V64 (= V64), N90 (= N90), A91 (= A91), G92 (= G92), T113 (≠ V113), M139 (≠ V139), S141 (= S141), Y154 (= Y154), K158 (= K158), P184 (= P184), G185 (= G185), T186 (≠ F186), T187 (= T187), T189 (≠ S189), E190 (≠ N190), L191 (≠ I191)
Sites not aligning to the query:
2japA Clavulanic acid dehydrogenase: structural and biochemical analysis of the final step in the biosynthesis of the beta- lactamase inhibitor clavulanic acid (see paper)
37% identity, 70% coverage: 3:192/272 of query aligns to 3:191/245 of 2japA
- active site: S140 (= S141), Y153 (= Y154), K157 (= K158)
- binding (2r,3z,5r)-3-(2-hydroxyethylidene)-7-oxo-4-oxa-1-azabicyclo[3.2.0]heptane-2-carboxylic acid: M93 (≠ S94), S140 (= S141), A142 (= A143), Y153 (= Y154), T185 (≠ F186)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G12), S14 (= S14), S15 (= S15), G16 (= G16), I17 (= I17), A36 (= A36), R37 (= R37), R38 (≠ Q38), L61 (≠ A62), D62 (= D63), V63 (= V64), N89 (= N90), A90 (= A91), G91 (= G92), T112 (≠ V113), M138 (≠ V139), S139 (= S140), S140 (= S141), Y153 (= Y154), K157 (= K158), P183 (= P184), T185 (≠ F186), T186 (= T187), T188 (≠ S189), E189 (≠ N190), L190 (≠ I191)
Sites not aligning to the query:
A0A1U8QWA2 Glycine betaine reductase ATRR; Nonribosomal peptide synthetase-like protein ATRR; EC 1.2.1.-; EC 1.1.1.- from Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans) (see paper)
32% identity, 81% coverage: 3:223/272 of query aligns to 1027:1246/1270 of A0A1U8QWA2
- G1036 (= G12) mutation to A: Compromises binding of the cosubstrate NADPH to aldehyde reductase domain R2. Decreases the aldehyde reductase activity by 4,000-fold; when associated with F-1178.
- Y1178 (= Y154) mutation to F: Does not substantially affect carboxylic acid reductase activity but results to a 150-fold loss of aldehyde reductase activity and the accumulation of glycine betaine aldehyde intermediate. Further decreases the aldehyde reductase activity by 4,000-fold; when associated with F-1178.
Sites not aligning to the query:
- 14:418 Adenylation (A) domain
- 643:937 Carboxylic acid reductase domain R1
- 812 Y→F: Abolishes overall carboxylic acid reductase activity but does nor affect aldehyde reductase activity.
- 1026:1256 Aldehyde reductase domain R2
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
30% identity, 68% coverage: 6:191/272 of query aligns to 2:188/239 of 3sj7A
- active site: G12 (= G16), S138 (= S141), Q148 (≠ R151), Y151 (= Y154), K155 (= K158)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G12), S10 (= S14), R11 (≠ S15), I13 (= I17), N31 (≠ A35), Y32 (≠ A36), A33 (≠ R37), G34 (≠ Q38), S35 (≠ Y39), A58 (= A62), N59 (≠ D63), V60 (= V64), N86 (= N90), A87 (= A91), T109 (≠ V113), S138 (= S141), Y151 (= Y154), K155 (= K158), P181 (= P184), G182 (= G185)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
30% identity, 68% coverage: 6:191/272 of query aligns to 5:191/246 of 3osuA
Query Sequence
>CA265_RS04990 FitnessBrowser__Pedo557:CA265_RS04990
MNLKEKVIIITGASSGIGKACAEEFAKRGANLVLAARQYVTLCEITADLEKKYNIRAVAV
QADVSKETDCELIIKQALVSFQKIDVLVNNAGLSMRALFNDLDLSVLKNLMDVNFWGTVY
CTKYALPEILKTKGTVVGVSSIAGFRGLPGRTGYSASKFAMNGFMESLRTELLKTGVNVL
LACPGFTASNIRVTALSKDGAAHGETSMDEGKMMTSEEVASIIADGIEKRKRTLIMTGQG
KLAVWMNKLFPAFVDKKVFDLFAKEKNPLIKG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory