SitesBLAST
Comparing CA265_RS05020 FitnessBrowser__Pedo557:CA265_RS05020 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5ey5B Lbcats
62% identity, 97% coverage: 9:389/393 of query aligns to 1:383/383 of 5ey5B
- binding pyridoxal-5'-phosphate: H81 (= H88), K82 (= K89), Q109 (= Q116), S185 (= S192), G227 (= G235), G229 (= G237), S230 (= S238), N231 (= N239), E345 (= E353), S371 (= S377), G372 (= G378)
8egzB Engineered tyrosine synthase (tmtyrs1) derived from t. Maritima trpb with ser bound as the amino-acrylate intermediate
60% identity, 97% coverage: 8:390/393 of query aligns to 1:380/386 of 8egzB
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H81 (= H88), K82 (= K89), T105 (= T112), G106 (= G113), A107 (= A114), Q109 (= Q116), H110 (= H117), S185 (= S192), G229 (= G237), S230 (= S238), N231 (= N239), G297 (= G306), E344 (= E353), S367 (= S377)
8eh0A Engineered tyrosine synthase (tmtyrs1) derived from t. Maritima trpb with ser bound as the amino-acrylate intermediate and complexed with quinoline n-oxide
60% identity, 97% coverage: 9:390/393 of query aligns to 1:379/385 of 8eh0A
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H80 (= H88), K81 (= K89), T104 (= T112), G105 (= G113), A106 (= A114), Q108 (= Q116), H109 (= H117), S184 (= S192), G228 (= G237), S229 (= S238), N230 (= N239), G296 (= G306), E343 (= E353), S366 (= S377), G367 (= G378)
- binding 1-oxo-1lambda~5~-quinoline: L160 (= L168), I164 (≠ T172), Y180 (= Y188), P182 (≠ I190), G183 (= G191), S184 (= S192), V186 (= V194), Y299 (= Y309)
8egyA Engineered holo tyrosine synthase (tmtyrs1) derived from t. Maritima trpb
60% identity, 97% coverage: 9:390/393 of query aligns to 1:379/385 of 8egyA
8eh1A Engineered tyrosine synthase (tmtyrs1) derived from t. Maritima trpb with ser bound as the amino-acrylate intermediate and complexed with 4-hydroxyquinoline
60% identity, 97% coverage: 9:390/393 of query aligns to 1:379/383 of 8eh1A
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H80 (= H88), K81 (= K89), T104 (= T112), G105 (= G113), A106 (= A114), Q108 (= Q116), H109 (= H117), S184 (= S192), G228 (= G237), S229 (= S238), N230 (= N239), G296 (= G306), E343 (= E353), S366 (= S377)
- binding quinolin-4-ol: G103 (≠ E111), L160 (= L168), I164 (≠ T172), G183 (= G191), S184 (= S192), Y299 (= Y309)
6usaB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and gsk1-bound form (see paper)
57% identity, 99% coverage: 6:393/393 of query aligns to 10:402/404 of 6usaB
- active site: K97 (= K89), E119 (= E111), S386 (= S377)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H96 (= H88), K97 (= K89), T120 (= T112), G121 (= G113), A122 (= A114), G123 (= G115), Q124 (= Q116), H125 (= H117), T200 (≠ S192), G242 (= G235), G244 (= G237), S245 (= S238), N246 (= N239), G313 (= G306), E360 (= E353), S386 (= S377)
- binding (3R,4R)-4-[4-(2-Chlorophenyl)piperazin-1-yl]-1,1-dioxothiolan-3-ol: F184 (≠ M176), W187 (= W179), Y196 (= Y188), F198 (≠ I190), G203 (= G195), P204 (= P196), F207 (≠ Y199), H290 (= H283), G291 (= G284)
6dweB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and brd0059-bound form
57% identity, 99% coverage: 6:393/393 of query aligns to 10:402/404 of 6dweB
- active site: K97 (= K89), E119 (= E111), S386 (= S377)
- binding (2R,3S,4R)-3-(2',6'-difluoro-4'-methyl[1,1'-biphenyl]-4-yl)-4-(fluoromethyl)azetidine-2-carbonitrile: F184 (≠ M176), Y196 (= Y188), F198 (≠ I190), P204 (= P196), F207 (≠ Y199), H290 (= H283)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H96 (= H88), K97 (= K89), T120 (= T112), G121 (= G113), A122 (= A114), G123 (= G115), Q124 (= Q116), H125 (= H117), T200 (≠ S192), G242 (= G235), G244 (= G237), S245 (= S238), N246 (= N239), G313 (= G306), E360 (= E353), S386 (= S377)
5tciH Crystal structure of tryptophan synthase from m. Tuberculosis - brd4592-bound form (see paper)
57% identity, 99% coverage: 6:393/393 of query aligns to 11:403/406 of 5tciH
- active site: K98 (= K89), E120 (= E111), S387 (= S377)
- binding (2R,3S,4R)-3-(2'-fluoro[1,1'-biphenyl]-4-yl)-4-(hydroxymethyl)azetidine-2-carbonitrile: P28 (= P20), L31 (= L23), Y197 (= Y188), F199 (≠ I190), P205 (= P196), F208 (≠ Y199), H291 (= H283)
6u6cB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and gsk2-bound form (see paper)
57% identity, 99% coverage: 6:393/393 of query aligns to 11:403/405 of 6u6cB
- active site: K98 (= K89), E120 (= E111), S387 (= S377)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H97 (= H88), K98 (= K89), T121 (= T112), G122 (= G113), A123 (= A114), Q125 (= Q116), H126 (= H117), T201 (≠ S192), G243 (= G235), G245 (= G237), S246 (= S238), N247 (= N239), G314 (= G306), E361 (= E353), S387 (= S377)
- binding 1-(2-fluorobenzene-1-carbonyl)-N-methyl-2,3-dihydro-1H-indole-5-sulfonamide: Y26 (= Y18), F185 (≠ M176), W188 (= W179), Y197 (= Y188), F199 (≠ I190), G204 (= G195), P205 (= P196), H291 (= H283), G292 (= G284)
6uapB Crystal structure of tryptophan synthase from m. Tuberculosis - open form with brd6309 bound
57% identity, 99% coverage: 6:393/393 of query aligns to 10:402/405 of 6uapB
- active site: K97 (= K89), E119 (= E111), S386 (= S377)
- binding (2R,3S,4R)-3-(4'-chloro-2',6'-difluoro[1,1'-biphenyl]-4-yl)-4-(fluoromethyl)azetidine-2-carbonitrile: I180 (≠ T172), N181 (= N173), F184 (≠ M176), Y196 (= Y188), F198 (≠ I190), P204 (= P196), F207 (≠ Y199), H290 (= H283)
5ocwB Structure of mycobacterium tuberculosis tryptophan synthase in space group f222 (see paper)
57% identity, 99% coverage: 6:393/393 of query aligns to 6:398/399 of 5ocwB
- active site: K93 (= K89), E115 (= E111), S382 (= S377)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H92 (= H88), K93 (= K89), T116 (= T112), G117 (= G113), A118 (= A114), Q120 (= Q116), H121 (= H117), T196 (≠ S192), G238 (= G235), G240 (= G237), S241 (= S238), N242 (= N239), G309 (= G306), E356 (= E353), S382 (= S377)
5dw0A Trpb from pyrococcus furiosus with l-serine bound as the external aldimine (see paper)
56% identity, 97% coverage: 10:389/393 of query aligns to 2:383/388 of 5dw0A
- active site: K82 (= K89), E104 (= E111), S371 (= S377)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-serine: H81 (= H88), K82 (= K89), T105 (= T112), G106 (= G113), A107 (= A114), Q109 (= Q116), H110 (= H117), S185 (= S192), G227 (= G235), G229 (= G237), S230 (= S238), N231 (= N239), G298 (= G306), D300 (= D308), E345 (= E353), S371 (= S377)
5t6mB Structure of the tryptophan synthase b-subunit from pyroccus furiosus with b-methyltryptophan non-covalently bound (see paper)
56% identity, 97% coverage: 10:389/393 of query aligns to 2:383/386 of 5t6mB
1v8zA X-ray crystal structure of the tryptophan synthase b2 subunit from hyperthermophile, pyrococcus furiosus (see paper)
56% identity, 97% coverage: 10:389/393 of query aligns to 2:383/386 of 1v8zA
- active site: K82 (= K89), E104 (= E111), S371 (= S377)
- binding pyridoxal-5'-phosphate: H81 (= H88), K82 (= K89), Q109 (= Q116), S185 (= S192), G227 (= G235), G228 (= G236), G229 (= G237), S230 (= S238), N231 (= N239), E345 (= E353), S371 (= S377), G372 (= G378)
6am8B Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9 with trp bound as e(aex2) (see paper)
56% identity, 97% coverage: 10:389/393 of query aligns to 2:383/385 of 6am8B
- active site: K82 (= K89), E104 (= E111), S371 (= S377)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-l-tryptophane: H81 (= H88), K82 (= K89), E104 (= E111), T105 (= T112), G106 (= G113), A107 (= A114), Q109 (= Q116), H110 (= H117), L161 (= L168), S185 (= S192), V187 (= V194), G227 (= G235), G228 (= G236), G229 (= G237), S230 (= S238), N231 (= N239), G298 (= G306), Y301 (= Y309), E345 (= E353), S371 (= S377), G372 (= G378)
- binding tryptophan: P12 (= P20), L169 (≠ M176), S274 (≠ L282), H275 (= H283)
5ixjD Tryptophan synthase beta-subunit from pyrococcus furiosus with l- threonine non-covalently bound in the active site (see paper)
56% identity, 97% coverage: 10:389/393 of query aligns to 2:381/394 of 5ixjD
5t6mA Structure of the tryptophan synthase b-subunit from pyroccus furiosus with b-methyltryptophan non-covalently bound (see paper)
56% identity, 97% coverage: 10:389/393 of query aligns to 2:381/383 of 5t6mA
5dw3A Tryptophan synthase beta-subunit from pyrococcus furiosus with product l-tryptophan non-covalently bound in the active site (see paper)
56% identity, 97% coverage: 10:389/393 of query aligns to 2:382/383 of 5dw3A
- active site: K82 (= K89), E104 (= E111), S370 (= S377)
- binding tryptophan: K82 (= K89), E104 (= E111), T105 (= T112), G106 (= G113), A107 (= A114), Q109 (= Q116), H110 (= H117), S185 (= S192), G228 (= G236), Y300 (= Y309)
7rnpA Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9_h275e with 4-cl-trp non-covalently bound (see paper)
55% identity, 97% coverage: 10:389/393 of query aligns to 2:383/384 of 7rnpA
6cuzA Engineered trpb from pyrococcus furiosus, pftrpb7e6 with (2s,3r)- ethylserine bound as the amino-acrylate (see paper)
56% identity, 97% coverage: 10:389/393 of query aligns to 2:383/383 of 6cuzA
- binding (2E)-2-[(E)-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)amino]pent-2-enoic acid: H81 (= H88), K82 (= K89), T105 (= T112), G106 (= G113), A107 (= A114), Q109 (= Q116), H110 (= H117), S185 (= S192), G227 (= G235), G229 (= G237), S230 (= S238), N231 (= N239), G298 (= G306), E345 (= E353), S371 (= S377)
Query Sequence
>CA265_RS05020 FitnessBrowser__Pedo557:CA265_RS05020
MKYKVNEKGYYGDFGGAYIPEMLYPNVEELRQNYLKIIDDADFQKEFHQLLKDYVGRPSP
LYLAKRYSERYGANIFLKREDLNHTGAHKINNTIGQILLAEKLGKKRIIAETGAGQHGVA
TATVCALRNLECVIYMGEVDIERQAPNVARMKMLGAKVVPASSGSKTLKDATNEAMRDWI
NNPVDTHYIIGSVVGPHPYPDMVAIFQSIISEETKKQLLEQTGSDQPDYVLACVGGGSNA
MGMFYHFMDDENVKLIAVEAAGKGVSSGFSAATTYLGKEGVLHGSRSILMQTEDGQVVEP
HSVSAGLDYPGIGPQHAHLFKTGRGQYVSITDEESLDAGLLCTQLEGIIPAIESAHALAY
LEKMEFKGGENVVVCLSGRGDKDLDTYIKYFNL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory