SitesBLAST
Comparing CA265_RS05180 FitnessBrowser__Pedo557:CA265_RS05180 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 17 hits to proteins with known functional sites (download)
3o6xA Crystal structure of the type iii glutamine synthetase from bacteroides fragilis (see paper)
50% identity, 99% coverage: 4:722/724 of query aligns to 2:637/638 of 3o6xA
- binding adenosine-5'-diphosphate: E180 (= E218), E244 (= E296), F249 (≠ Y301), N295 (= N347), S297 (= S349), R388 (≠ K471), E390 (= E473)
- binding magnesium ion: E180 (= E218), E182 (= E220), E237 (= E289), E244 (= E296), H293 (= H345), E390 (= E473)
- binding l-methionine-s-sulfoximine phosphate: E180 (= E218), E182 (= E220), E237 (= E289), G289 (= G341), G291 (= G343), H293 (= H345), R349 (= R401), E354 (= E406), R378 (= R461)
7tf9S L. Monocytogenes gs(14)-q-glnr peptide (see paper)
33% identity, 20% coverage: 214:355/724 of query aligns to 127:254/443 of 7tf9S
Sites not aligning to the query:
7tenA Glutamine synthetase (see paper)
33% identity, 20% coverage: 214:355/724 of query aligns to 126:253/442 of 7tenA
- binding adenosine-5'-diphosphate: G128 (= G216), E130 (= E218), E182 (≠ K284), D196 (≠ A298), F197 (≠ P299), K198 (≠ I300), Y199 (= Y301), N245 (= N347), S247 (= S349)
- binding l-methionine-s-sulfoximine phosphate: E130 (= E218), E132 (= E220), E187 (= E289), E194 (= E296), N238 (= N340), G239 (= G341), H243 (= H345)
Sites not aligning to the query:
7tfaB Glutamine synthetase (see paper)
36% identity, 10% coverage: 278:353/724 of query aligns to 175:250/441 of 7tfaB
Sites not aligning to the query:
- binding glutamine: 131, 153, 295, 301
- binding magnesium ion: 129, 131, 330
- binding : 58, 60, 299, 300, 313, 424
7tdpA Structure of paenibacillus polymyxa gs bound to met-sox-p-adp (transition state complex) to 1.98 angstom (see paper)
36% identity, 10% coverage: 278:353/724 of query aligns to 173:248/439 of 7tdpA
- binding adenosine-5'-diphosphate: E179 (≠ K284), D193 (≠ A298), Y196 (= Y301), N242 (= N347), S244 (= S349)
- binding magnesium ion: E184 (= E289), E191 (= E296), E191 (= E296), H240 (= H345)
- binding l-methionine-s-sulfoximine phosphate: E184 (= E289), E191 (= E296), G236 (= G341), H240 (= H345)
Sites not aligning to the query:
- binding adenosine-5'-diphosphate: 123, 125, 127, 316, 326
- binding magnesium ion: 127, 127, 129, 328
- binding l-methionine-s-sulfoximine phosphate: 127, 129, 293, 299, 311, 330
7tf6A Glutamine synthetase (see paper)
36% identity, 10% coverage: 279:351/724 of query aligns to 173:245/438 of 7tf6A
Sites not aligning to the query:
- binding glutamine: 128, 292, 298
- binding magnesium ion: 126, 128, 327
- binding : 58, 60, 296, 297, 310, 367, 421, 433, 437
7tdvC Glutamine synthetase (see paper)
36% identity, 10% coverage: 279:351/724 of query aligns to 178:250/443 of 7tdvC
- binding adenosine-5'-diphosphate: E183 (≠ K284), D197 (≠ A298), F198 (≠ P299), K199 (≠ I300), Y200 (= Y301), N246 (= N347), V247 (≠ W348), S248 (= S349)
- binding magnesium ion: E188 (= E289), E195 (= E296), E195 (= E296), H244 (= H345)
- binding l-methionine-s-sulfoximine phosphate: E188 (= E289), E195 (= E296), G240 (= G341), H244 (= H345)
Sites not aligning to the query:
- binding adenosine-5'-diphosphate: 129, 131, 320, 328, 330
- binding magnesium ion: 131, 131, 133, 332
- binding l-methionine-s-sulfoximine phosphate: 131, 133, 297, 303, 315
7cquA Gmas/adp/metsox-p complex (see paper)
30% identity, 20% coverage: 216:359/724 of query aligns to 119:248/429 of 7cquA
- binding adenosine-5'-diphosphate: E121 (= E218), Y173 (≠ L283), N187 (≠ A298), W188 (≠ P299), D189 (≠ I300), Y190 (= Y301), H236 (≠ N347), L237 (≠ W348), S238 (= S349)
- binding magnesium ion: E121 (= E218), E121 (= E218), E123 (= E220), E178 (= E289), E185 (= E296), E185 (= E296), H234 (= H345)
- binding l-methionine-s-sulfoximine phosphate: E121 (= E218), E123 (= E220), E178 (= E289), E185 (= E296), T229 (≠ N340), G230 (= G341), H234 (= H345)
Sites not aligning to the query:
7cqqA Gmas in complex with amppnp and metsox (see paper)
30% identity, 20% coverage: 216:359/724 of query aligns to 119:248/429 of 7cqqA
- binding phosphoaminophosphonic acid-adenylate ester: E121 (= E218), Y173 (≠ L283), E185 (= E296), N187 (≠ A298), D189 (≠ I300), Y190 (= Y301), H234 (= H345), H236 (≠ N347), S238 (= S349)
- binding magnesium ion: E121 (= E218), E121 (= E218), E123 (= E220), E178 (= E289), E185 (= E296), E185 (= E296), H234 (= H345)
- binding (2s)-2-amino-4-(methylsulfonimidoyl)butanoic acid: E123 (= E220), E178 (= E289), T229 (≠ N340), H234 (= H345)
Sites not aligning to the query:
7cqnA Gmas in complex with amppcp (see paper)
30% identity, 20% coverage: 216:359/724 of query aligns to 119:248/429 of 7cqnA
Sites not aligning to the query:
7cqwA Gmas/adp complex-conformation 1 (see paper)
30% identity, 20% coverage: 216:359/724 of query aligns to 120:249/430 of 7cqwA
Sites not aligning to the query:
8tfkA Glutamine synthetase (see paper)
32% identity, 12% coverage: 279:365/724 of query aligns to 175:260/440 of 8tfkA
Sites not aligning to the query:
- binding adenosine-5'-diphosphate: 128, 312, 317, 325, 327
- binding magnesium ion: 128, 128, 130, 329
- binding l-methionine-s-sulfoximine phosphate: 128, 130, 294, 300, 312, 331
8ufjB Glutamine synthetase (see paper)
32% identity, 12% coverage: 279:365/724 of query aligns to 179:264/444 of 8ufjB
Sites not aligning to the query:
4lnkA B. Subtilis glutamine synthetase structures reveal large active site conformational changes and basis for isoenzyme specific regulation: structure of gs-glutamate-amppcp complex (see paper)
33% identity, 10% coverage: 278:353/724 of query aligns to 177:252/443 of 4lnkA
- active site: E188 (= E289), E195 (= E296), H244 (= H345)
- binding adenosine-5'-diphosphate: F198 (≠ P299), Y200 (= Y301), N246 (= N347), S248 (= S349)
- binding glutamic acid: E188 (= E289), V189 (= V290), N239 (= N340), G240 (= G341), G242 (= G343)
- binding magnesium ion: E188 (= E289), E195 (= E296), H244 (= H345)
Sites not aligning to the query:
- active site: 52, 131, 133, 315, 332, 334
- binding adenosine-5'-diphosphate: 43, 50, 324, 328, 330
- binding glutamic acid: 133, 303
- binding magnesium ion: 131, 332
4lniA B. Subtilis glutamine synthetase structures reveal large active site conformational changes and basis for isoenzyme specific regulation: structure of the transition state complex (see paper)
33% identity, 10% coverage: 278:353/724 of query aligns to 177:252/443 of 4lniA
- active site: E188 (= E289), E195 (= E296), H244 (= H345)
- binding adenosine-5'-diphosphate: E183 (≠ K284), D197 (≠ A298), Y200 (= Y301), N246 (= N347), S248 (= S349)
- binding magnesium ion: E188 (= E289), E195 (= E296), E195 (= E296), H244 (= H345)
- binding l-methionine-s-sulfoximine phosphate: E188 (= E289), H244 (= H345)
Sites not aligning to the query:
- active site: 52, 131, 133, 315, 332, 334
- binding adenosine-5'-diphosphate: 131, 320, 330
- binding magnesium ion: 131, 131, 133, 332
- binding l-methionine-s-sulfoximine phosphate: 133, 297, 303, 315, 334
P12425 Glutamine synthetase; GS; Glutamate--ammonia ligase; Glutamine synthetase I alpha; GSI alpha; EC 6.3.1.2 from Bacillus subtilis (strain 168) (see 5 papers)
33% identity, 10% coverage: 278:353/724 of query aligns to 178:253/444 of P12425
- E189 (= E289) binding
- V190 (= V290) mutation to A: Unable to form stable complex with TnrA. In the presence of glutamine, this mutant partially relieves expression of the glnRA-lacZ fusion, but has no effect on the TnrA-dependent regulation of amtB-lacZ fusion. Resistant to inhibition by MetSox.
- E196 (= E296) binding
- G241 (= G341) binding
- H245 (= H345) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 59 G→R: Unable to form stable complex with TnrA. In the presence of glutamine, this mutant derepresses amtB-lacZ fusion and glnRA-lacZ fusion.
- 62 Important for inhibition by glutamine; R→A: Highly resistant to inhibition by glutamine and AMP. Regulation by TnrA and GlnR is abolished. Only small differences (less than 2-fold) in its steady-state kinetic constants compared with the wild-type. Similar sensitivity to Met-Sox that compared to the wild-ytpe.
- 132 binding
- 134 binding
- 302 G→E: Unable to form stable complex with TnrA. In the presence of glutamine, amtB-lacZ fusion is only 4-fold regulated by TnrA, whereas glnRA-lacZ fusion is derepressed. This mutant retains enzymatic specific activity with a 2-fold decrease of the affinity for glutamate and glutamine compared to the wild-type. Slightly less sensitive to inhibition by glutamine.
- 304 E→A: Highly resistant to Met-Sox inhibition. 8- and 2-fold increase of the affinity for glutamate and ATP, respectively. Strong decrease of the affinity for ammonium.
- 306 P→H: Unable to form stable complex with TnrA. In the presence of glutamine, this mutant completely derepresses glnRA-lacZ fusion, whereas amtB-lacZ fusion expression is only partially derepresses.
- 333 binding
- 424 E→K: Unable to form stable complex with TnrA. In the presence of glutamine, this mutant derepresses amtB-lacZ fusion and glnRA-lacZ fusion. Although it is defective in regulation, this mutant retains enzymatic specific activity and similar affinity for ATP, glutamate and glutamine compared to the wild-type. Slightly less sensitive to inhibition by glutamine.
4s0rD Structure of gs-tnra complex (see paper)
33% identity, 10% coverage: 278:353/724 of query aligns to 181:256/447 of 4s0rD
Sites not aligning to the query:
- active site: 56, 135, 137, 319, 336, 338
- binding glutamine: 137, 301, 307
- binding magnesium ion: 66, 135, 135, 336, 419
- binding : 63, 64, 65, 66, 161, 305, 306, 376, 426, 430
Query Sequence
>CA265_RS05180 FitnessBrowser__Pedo557:CA265_RS05180
MKSLRTIALKEAQNRISPEVKSPSAKISDFFGANVFDKRKMRDFLSKDVYEKLISSINQG
ELINAEDANQIATAMKSWAMAAGATHYTHWFQPLTGTTAEKHDSFFEPSGEGAIEKFAGS
ALVQQEPDASSFPNGGIRNTFEARGYTAWDPSSPAFIMESKAGKTLCIPTVFVSYTGEAL
DYKAPLLKALASLDKAAVDVCQYFDKSITKVNASLGIEQEYFLVDESLFNARPDLLLTGR
ALFGHMSAKGQQLEDHYFGSIPERVFSYMVDFENEALKLGIPLKTRHNEVAPSQFECAPI
YEEINLAIDHNQLLMDLMEKVARRHHFRVLLHEKPYAGINGSGKHNNWSLITDTGKNLLA
PGKTPKNNLMFLAFFVNTIKAVSEHADLLRASIASVSNDHRLGANEAPPAIISIFLGSQL
NDVLDEIEHSRISKKIKEDNALWLGIPKIPQILLDNTDRNRTSPFAFTGNKFELRAVGSS
ANSSAPMTILNAIMAEQLVKFKVEVDKLIKKGDKKDIALLTVIKKYIKESKNIRFEGNGY
SQEWEDEAATRGLSNIKTTPKALDAYLTEKSAELFASTGIYSAREIHARHEIMLENFYKK
LQIEARVMGEVANTAIIPAAIAYQNSLIENVKGLKELGVDSKSSLDIVKKLSEHLDIVKT
NIDAMLEERKLTNKIEDTREKAIAYDEKVKSYFDTIRYHADKLEQIVDDSVWPLPKFREL
LFMK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory