Comparing CA265_RS05705 FitnessBrowser__Pedo557:CA265_RS05705 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1eyyA Crystal structure of the NADP+ dependent aldehyde dehydrogenase from vibrio harveyi. (see paper)
44% identity, 95% coverage: 21:522/528 of query aligns to 7:502/504 of 1eyyA
3ty7B Crystal structure of aldehyde dehydrogenase family protein from staphylococcus aureus
28% identity, 60% coverage: 11:328/528 of query aligns to 14:307/454 of 3ty7B
Sites not aligning to the query:
5x5uA Crystal structure of alpha-ketoglutarate-semialdehyde dehydrogenase (kgsadh) complexed with NAD (see paper)
30% identity, 58% coverage: 17:324/528 of query aligns to 20:307/476 of 5x5uA
Sites not aligning to the query:
5x5tA Crystal structure of alpha-ketoglutarate semialdehyde dehydrogenase (kgsadh) from azospirillum brasilense (see paper)
30% identity, 58% coverage: 17:324/528 of query aligns to 20:307/476 of 5x5tA
Sites not aligning to the query:
O24174 Betaine aldehyde dehydrogenase 1; OsBADH1; EC 1.2.1.8 from Oryza sativa subsp. japonica (Rice) (see paper)
29% identity, 55% coverage: 17:307/528 of query aligns to 25:303/505 of O24174
4cazA Crystal structure of betaine aldehyde dehydrogenase from pseudomonas aeruginosa in complex with nadh
25% identity, 78% coverage: 7:418/528 of query aligns to 10:434/489 of 4cazA
Sites not aligning to the query:
2woxA Betaine aldehyde dehydrogenase from pseudomonas aeruginosa with NAD(p) h-catalytic thiol adduct. (see paper)
25% identity, 78% coverage: 7:418/528 of query aligns to 10:434/489 of 2woxA
Sites not aligning to the query:
2wmeA Crystallographic structure of betaine aldehyde dehydrogenase from pseudomonas aeruginosa (see paper)
25% identity, 78% coverage: 7:418/528 of query aligns to 10:434/489 of 2wmeA
Sites not aligning to the query:
Q9HTJ1 NAD/NADP-dependent betaine aldehyde dehydrogenase; BADH; EC 1.2.1.8 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 2 papers)
25% identity, 78% coverage: 7:418/528 of query aligns to 11:435/490 of Q9HTJ1
Sites not aligning to the query:
P25526 Succinate-semialdehyde dehydrogenase [NADP(+)] GabD; SSDH; Glutarate-semialdehyde dehydrogenase; EC 1.2.1.79; EC 1.2.1.- from Escherichia coli (strain K12) (see paper)
27% identity, 63% coverage: 4:338/528 of query aligns to 12:326/482 of P25526
Sites not aligning to the query:
5u0mA Fatty aldehyde dehydrogenase from marinobacter aquaeolei vt8 and cofactor complex (see paper)
26% identity, 97% coverage: 1:510/528 of query aligns to 2:485/488 of 5u0mA
5u0lA X-ray crystal structure of fatty aldehyde dehydrogenase enzymes from marinobacter aquaeolei vt8 complexed with a substrate (see paper)
26% identity, 97% coverage: 1:510/528 of query aligns to 2:485/488 of 5u0lA
3jz4A Crystal structure of e. Coli NADP dependent enzyme (see paper)
27% identity, 63% coverage: 4:338/528 of query aligns to 11:325/481 of 3jz4A
Sites not aligning to the query:
Q8VWZ1 Aminoaldehyde dehydrogenase 1, peroxisomal; PsAMADH1; Aminobutyraldehyde dehydrogenase AMADH1; Gamma-guanidinobutyraldehyde dehydrogenase AMADH1; EC 1.2.1.-; EC 1.2.1.19; EC 1.2.1.54 from Pisum sativum (Garden pea) (Lathyrus oleraceus) (see paper)
26% identity, 59% coverage: 14:324/528 of query aligns to 21:318/503 of Q8VWZ1
Sites not aligning to the query:
3iwkH Crystal structure of aminoaldehyde dehydrogenase 1 from pisum sativum (psamadh1) (see paper)
26% identity, 59% coverage: 14:324/528 of query aligns to 16:313/497 of 3iwkH
Sites not aligning to the query:
3rhdA Crystal structure of glyceraldehyde-3-phosphate dehydrogenase gapn from methanocaldococcus jannaschii dsm 2661 complexed with NADP
27% identity, 57% coverage: 14:313/528 of query aligns to 1:280/456 of 3rhdA
Sites not aligning to the query:
5ur2B Crystal structure of proline utilization a (puta) from bdellovibrio bacteriovorus inactivated by n-propargylglycine (see paper)
28% identity, 51% coverage: 12:282/528 of query aligns to 475:736/959 of 5ur2B
Sites not aligning to the query:
3iwjA Crystal structure of aminoaldehyde dehydrogenase 2 from pisum sativum (psamadh2) (see paper)
27% identity, 76% coverage: 14:416/528 of query aligns to 18:410/500 of 3iwjA
Sites not aligning to the query:
Q93YB2 Aminoaldehyde dehydrogenase 2, peroxisomal; PsAMADH2; Aminobutyraldehyde dehydrogenase AMADH2; Gamma-guanidinobutyraldehyde dehydrogenase AMADH2; EC 1.2.1.-; EC 1.2.1.19; EC 1.2.1.54 from Pisum sativum (Garden pea) (Lathyrus oleraceus) (see paper)
27% identity, 76% coverage: 14:416/528 of query aligns to 21:413/503 of Q93YB2
Q84LK3 Betaine aldehyde dehydrogenase 2; OsBADH2; EC 1.2.1.8 from Oryza sativa subsp. japonica (Rice) (see paper)
27% identity, 41% coverage: 57:273/528 of query aligns to 60:270/503 of Q84LK3
>CA265_RS05705 FitnessBrowser__Pedo557:CA265_RS05705
MNGQNIVASTYIEVNERSLKAVNPATGLTLDGDFFKASERLVDDALTSATLAFQSYRNLN
KDLKAAFLNAIADEIANLGEELVNRASAESGLPLGRLQGELGRTTGQLRLFANLVAEGSW
VDAIIDTALPERQPLPRPDIRRMLIPIGPVVVFGASNFPLAFSVAGGDTASALASGCPVV
VKAHPAHYGTSALVGGAIIKAAEKTGMPKGVFSLLYDDGYTIGAGLVQHPLTKAVTFTGS
FKGGMALINLAQQREQPIPVFAEMGSINPVIFLPKAIENQAEELAKKYAASITLGAGQFC
TNPGLLLAVQSPALESFKAALKEAISTIPSATMLTEGIASNYGKLSAEVVNEGGVALLSA
STVKNTELQNQSEAKIAQVSAADFIKNPKLREEIFGPYSLLVVAQDIAELEKAIDVLEGQ
LTVTLMAEKQELQGYQTLVNKLTDKTGRIILNGVPTGVEVCAAMQHGGPFPATNDSRFTS
VGSTAINRFARPLAYQDWEQELLPDELKDGNPLGIFRTINQKLTKSHE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory