SitesBLAST
Comparing CA265_RS06080 FitnessBrowser__Pedo557:CA265_RS06080 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6eonA Galactanase bt0290 (see paper)
42% identity, 95% coverage: 25:606/611 of query aligns to 2:588/754 of 6eonA
Sites not aligning to the query:
3wf2A Crystal structure of human beta-galactosidase in complex with nbt-dgj
39% identity, 94% coverage: 33:604/611 of query aligns to 13:604/605 of 3wf2A
- binding (2R,3S,4R,5S)-N-butyl-3,4,5-trihydroxy-2-(hydroxymethyl)piperidine-1-carbothioamide: Y55 (= Y75), A100 (= A120), E101 (= E121), N159 (= N179), E160 (= E180), E240 (= E255), L246 (≠ F261), N293 (= N308), Y305 (= Y324), Y457 (≠ F471)
3wf1A Crystal structure of human beta-galactosidase in complex with 6s-nbi- gj
39% identity, 94% coverage: 33:604/611 of query aligns to 13:604/605 of 3wf1A
- binding (3E,5S,6R,7S,8S,8aS)-3-(butylimino)hexahydro[1,3]thiazolo[3,4-a]pyridine-5,6,7,8-tetrol: Y55 (= Y75), C99 (= C119), A100 (= A120), E101 (= E121), E160 (= E180), E240 (= E255), Y242 (= Y257), W245 (= W260), Y278 (= Y293), Y305 (= Y324)
3wf0A Crystal structure of human beta-galactosidase in complex with 6s-nbi- dgj
39% identity, 94% coverage: 33:604/611 of query aligns to 13:604/605 of 3wf0A
- binding (3Z,6S,7R,8S,8aS)-3-(butylimino)hexahydro[1,3]thiazolo[3,4-a]pyridine-6,7,8-triol: Y55 (= Y75), C99 (= C119), A100 (= A120), E101 (= E121), N159 (= N179), E160 (= E180), E240 (= E255), W245 (= W260), L246 (≠ F261), Y457 (≠ F471)
3wezA Crystal structure of human beta-galactosidase in complex with noev
39% identity, 94% coverage: 33:604/611 of query aligns to 13:604/605 of 3wezA
- binding (1S,2S,3S,6R)-4-(hydroxymethyl)-6-(octylamino)cyclohex-4-ene-1,2,3-triol: Y55 (= Y75), C99 (= C119), A100 (= A120), E101 (= E121), E160 (= E180), E240 (= E255), Y242 (= Y257), L246 (≠ F261), N293 (= N308), Y305 (= Y324), Y457 (≠ F471)
3thdA Crystal structure of human beta-galactosidase in complex with 1- deoxygalactonojirimycin (see paper)
39% identity, 94% coverage: 33:604/611 of query aligns to 13:604/605 of 3thdA
- binding (2R,3S,4R,5S)-2-(hydroxymethyl)piperidine-3,4,5-triol: Y55 (= Y75), C99 (= C119), A100 (= A120), E101 (= E121), N159 (= N179), E160 (= E180), E240 (= E255), Y305 (= Y324)
- binding sulfate ion: S294 (= S313), P295 (= P314), Y296 (= Y315), R323 (= R342), Q327 (≠ E346), R429 (= R441), N430 (≠ R442)
3thcA Crystal structure of human beta-galactosidase in complex with galactose (see paper)
39% identity, 94% coverage: 33:604/611 of query aligns to 13:604/605 of 3thcA
- binding beta-D-galactopyranose: Y55 (= Y75), C99 (= C119), A100 (= A120), E101 (= E121), E160 (= E180), E240 (= E255), Y242 (= Y257), Y278 (= Y293), Y305 (= Y324)
- binding sulfate ion: S294 (= S313), P295 (= P314), Y296 (= Y315), R323 (= R342), Q327 (≠ E346), R429 (= R441), N430 (≠ R442)
P16278 Beta-galactosidase; Acid beta-galactosidase; Lactase; Elastin receptor 1; EC 3.2.1.23 from Homo sapiens (Human) (see 33 papers)
38% identity, 94% coverage: 33:604/611 of query aligns to 41:646/677 of P16278
- R49 (≠ Q41) to C: in GM1G1 and GM1G2; decrease in galactosidase activity; dbSNP:rs72555358
- I51 (= I43) to T: in GM1G3; no effect on catalytic activity; decreased protein stability; dbSNP:rs72555390
- R59 (= R51) to C: in GM1G1; loss of galactosidase activity; severe mutation; dbSNP:rs756878418; to H: in GM1G1; with cardiac involvement in some patients; loss of galactosidase activity; severe mutation; dbSNP:rs72555392
- R68 (= R60) to Q: in GM1G2; 7.4% of wild-type galactosidase activity; dbSNP:rs572237881; to W: in GM1G2 and GM1G1; loss of galactosidase activity; dbSNP:rs72555370
- T82 (= T74) to M: in GM1G3; mild phenotype; dbSNP:rs72555393
- Y83 (= Y75) binding ; to C: in MPS4B; decrease in galactosidase activity; dbSNP:rs1553612220; to H: in MPS4B; 2-5% of wild-type galactosidase activity; dbSNP:rs72555364
- G123 (≠ S115) to R: in GM1G1; decrease in galactosidase activity; dbSNP:rs28934274
- E129 (= E121) binding ; to Q: in dbSNP:rs886042079
- M132 (≠ F124) to T: in GM1G1; 4.3% of wild-type galactosidase activity; dbSNP:rs1553612189
- G134 (= G126) to R: in GM1G2; uncertain significance
- R148 (= R140) to C: in GM1G3 and GM1G2; dbSNP:rs192732174
- S149 (= S141) to F: in MPS4B; 2.0% of wild-type galactosidase activity; dbSNP:rs778700089
- D151 (≠ E143) to Y: in GM1G1; complete lack of protein; loss of galactosidase activity
- L155 (= L147) to R: in GM1G2 and GM1G3; 6.7% of wild-type galactosidase activity; dbSNP:rs376710410
- L162 (≠ I154) to S: in GM1G1; loss of galactosidase activity
- L173 (≠ Q165) to P: in GM1G1; loss of galactosidase activity; dbSNP:rs397515617
- Q184 (= Q176) to R: in GM1G1; loss of galactosidase activity
- N187 (= N179) binding
- G190 (= G182) to D: in GM1G1; 3.4% of wild-type galactosidase activity; dbSNP:rs756575833
- C195 (≠ A186) modified: Disulfide link with 230
- D198 (≠ N189) to Y: in MPS4B; 17.4% of wild-type galactosidase activity
- R201 (≠ D192) to C: in GM1G1 and GM1G2; no effect on intrinsic catalytic activity; decreased protein stability; 8.4% of wild-type galactosidase activity; activity severely reduced in transfection with variant F-436; dbSNP:rs72555360; to H: in GM1G1 and GM1G2; also in a patient with a slowly progressive GM1-gangliosidosis form; 36.2% of wild-type galactosidase activity; dbSNP:rs189115557
- C230 (≠ D218) modified: Disulfide link with 195
- L236 (= L224) to P: in GM1G1; decrease in galactosidase activity
- T239 (≠ A227) to M: in GM1G1; loss of galactosidase activity; severe mutation; causes a rapid degradation of the protein precursor; dbSNP:rs746766232
- N247 (≠ P234) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- Q255 (≠ N242) to H: in GM1G1; 2.4% of wild-type galactosidase activity; dbSNP:rs1553610553
- G262 (= G249) to E: in GM1G2; decrease in galactosidase activity; dbSNP:rs377174858
- Y270 (= Y257) to D: in GM1G3; originally classified as Morquio syndrome; dbSNP:rs376663785
- W273 (= W260) to L: in MPS4B; decreased galactosidase activity; dbSNP:rs72555362
- H281 (= H268) to Y: in GM1G1 and GM1G3; dbSNP:rs745386663
- L297 (= L284) to F: in GM1G3; decrease in galactosidase activity
- F314 (≠ R301) to L: in GM1G2; decrease in galactosidase activity
- N318 (= N305) to H: in GM1G1; uncertain significance
- T329 (≠ S320) to I: in GM1G1; 5.0% of wild-type galactosidase activity
- Y331 (= Y322) to C: in GM1G1; uncertain significance
- D332 (= D323) to E: in GM1G1; 2.3% of wild-type galactosidase activity; to N: in GM1G1; decrease in galactosidase activity; dbSNP:rs781658798
- Y333 (= Y324) binding ; to H: in GM1G2; 3.0% of wild-type galactosidase activity; the mutant protein is localized in the lysosomal-endosomal compartment
- L337 (= L328) to P: in GM1G1 and GM1G2; loss of galactosidase activity; dbSNP:rs752177002
- P397 (≠ A385) to A: in MPS4B; 24.0% of wild-type galactosidase activity
- Q408 (≠ D396) to P: in MPS4B; 1.1% of wild-type galactosidase activity; dbSNP:rs72555369
- G414 (= G402) to V: in GM1G2; decrease in galactosidase activity
- T420 (= T408) to K: in GM1G3; decrease in galactosidase activity; to P: in GM1G1; loss of galactosidase activity; dbSNP:rs200181401
- S434 (≠ Q422) to L: in GM1-gangliosidosis; unclassified clinical type; dbSNP:rs267599773
- L436 (vs. gap) to F: seems to have a modulating action in the expression of the severity of other mutations; dbSNP:rs34421970
- G438 (vs. gap) to E: in GM1G3 and MPS4B; mild form; 5.7% of wild-type galactosidase activity; dbSNP:rs72555367
- D441 (= D425) to N: in GM1G1; loss of galactosidase activity; dbSNP:rs780724173
- Y444 (≠ L428) to C: in MPS4B; loss of galactosidase activity
- N464 (≠ S449) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- R482 (= R468) to C: in MPS4B; loss of galactosidase activity; dbSNP:rs72555365; to H: in MPS4B and GM1G1; severe decrease in galactosidase activity; dbSNP:rs72555391
- N484 (= N470) to K: in MPS4B; mild form; fibroblasts from MPS4B compound heterozygotes for K-484 and A-500 have 1.9% of wild-type galactosidase activity; dbSNP:rs968221254
- K493 (= K480) to N: in GM1G2; decrease in galactosidase activity; dbSNP:rs1172435886
- G494 (= G481) to S: in MPS4B; loss of galactosidase activity
- N498 (≠ Q485) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- T500 (= T487) to A: in MPS4B; mild form; 2.1% of wild-type galactosidase activity; dbSNP:rs72555368
- W509 (= W496) to C: in MPS4B; also in a patient with a slowly progressive form of GM1-gangliosidosis; loss of galactosidase activity; dbSNP:rs72555363
- L514 (≠ F503) to P: in GM1G1; decrease in galactosidase activity
- R521 (≠ I510) to C: in GM1G3; likely benign; galactosidase activity is reduced in homozygous patient fibroblasts to 30% of control values; has 25% of wild-type galactosidase activity when expressed in a heterologous system; dbSNP:rs4302331
- S532 (vs. gap) to G: results in near-normal activity corresponding to 60%-100% of the wild-type depending on the expression system; dbSNP:rs73826339
- G554 (= G526) to E: in GM1-gangliosidosis; unclassified clinical type
- N555 (≠ S527) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- G579 (= G546) to D: in GM1G1 and GM1G2; loss of galactosidase activity; severe mutation; dbSNP:rs746350513
- R590 (≠ K557) to C: in GM1G1; loss of galactosidase activity; dbSNP:rs794727165
- Y591 (= Y558) to C: in GM1G1; with cardiac involvement in some patients; loss of galactosidase activity; severe mutation; causes a rapid degradation of the protein precursor; dbSNP:rs72555371; to N: in GM1G1; with cardiac involvement in some patients; loss of galactosidase activity; severe mutation; causes a rapid degradation of the protein precursor; dbSNP:rs72555373
- R595 (≠ I561) to W: reduction of galactosidase activity; dbSNP:rs201807974
- P597 (= P563) to L: in GM1G2; decrease in galactosidase activity; to S: in GM1G1; 2.1% of wild-type galactosidase activity
- T600 (= T566) to I: in GM1G2; decrease in galactosidase activity
- C626 (vs. gap) modified: Disulfide link with 634
- C634 (≠ N592) modified: Disulfide link with 626
Sites not aligning to the query:
- 10 P → L: in dbSNP:rs7637099
4e8cA Crystal structure of streptococcal beta-galactosidase in complex with galactose (see paper)
37% identity, 95% coverage: 32:610/611 of query aligns to 8:594/594 of 4e8cA
3w5fA Crystal structure of tomato beta-galactosidase 4
31% identity, 54% coverage: 21:351/611 of query aligns to 1:324/701 of 3w5fA
6ik5A Crystal structure of tomato beta-galactosidase (tbg) 4 in complex with galactose (see paper)
32% identity, 52% coverage: 33:351/611 of query aligns to 11:322/705 of 6ik5A
O58247 Exo-beta-D-glucosaminidase; GlcNase; EC 3.2.1.- from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see paper)
34% identity, 27% coverage: 19:180/611 of query aligns to 3:181/778 of O58247
- D180 (≠ N179) mutation to N: Loss of activity.
- E181 (= E180) mutation to Q: Retains 10% of wild-type activity.
Sites not aligning to the query:
- 308 E→Q: Retains 15% of wild-type activity.
- 349 E→Q: Loss of activity.
A2QAN3 Beta-galactosidase A; An-beta-gal; Lactase A; EC 3.2.1.23 from Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) (see paper)
29% identity, 54% coverage: 13:342/611 of query aligns to 28:383/1007 of A2QAN3
- Y96 (= Y75) binding
- NAE 140:142 (≠ CAE 119:121) binding
- N156 (≠ K135) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N199 (= N179) binding
- C205 (≠ A185) modified: Disulfide link with 206
- C206 (≠ A186) modified: Disulfide link with 205
- C266 (vs. gap) modified: Disulfide link with 315
- E298 (= E255) active site, Nucleophile; mutation to Q: Loss of hydrolytic activity.
- Y304 (≠ F261) mutation to A: Nearly complete loss of hydrolytic activity against lactose compared to wild-type due to decreased substrate affinity.; mutation to F: Over 33% increase of hydrolytic activity against lactose compared to wild-type. No effect on hydrolytic activity compared to wild-type; when associated with H-355 and G-357. 58% reduction in hydrolytic activity compared to wild-type; when associated with H-355, G-357 and F-806.
- C315 (≠ P272) modified: Disulfide link with 266
- Y355 (= Y315) mutation to H: No effect on hydrolytic activity compared to wild-type; when associated with F-304 and G-357. 58% reduction in hydrolytic activity compared to wild-type; when associated with F-304, G-357 and F-806.
- N357 (≠ P317) mutation to G: No effect on hydrolytic activity compared to wild-type; when associated with F-304 and H-355. 58% reduction in hydrolytic activity compared to wild-type; when associated with F-304, H-355 and F-806.
- Y364 (= Y324) binding
Sites not aligning to the query:
- 402 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 478 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 522 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 622 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 739 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 760 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 777 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 806 W→F: 43% loss of hydrolytic activity against lactose compared to wild-type. 58% reduction in hydrolytic activity compared to wild-type; when associated with F-304, H-355 and G-357.; W→S: 90% loss of hydrolytic activity against lactose compared to wild-type.
- 914 modified: carbohydrate, N-linked (GlcNAc...) asparagine
5ifpA Structure of beta-galactosidase from aspergillus niger (see paper)
29% identity, 51% coverage: 30:342/611 of query aligns to 10:343/968 of 5ifpA
Sites not aligning to the query:
5iftA Structure of e298q-beta-galactosidase from aspergillus niger in complex with 3-b-galactopyranosyl glucose (see paper)
29% identity, 51% coverage: 30:342/611 of query aligns to 10:343/968 of 5iftA
- binding beta-D-galactopyranose: Y56 (= Y75), N100 (≠ C119), A101 (= A120), E102 (= E121), E160 (= E180), Q258 (≠ E255), Y264 (≠ F261), Y302 (= Y293), Y324 (= Y324)
- binding alpha-D-glucopyranose: E160 (= E180), F224 (vs. gap)
- binding alpha-D-mannopyranose: W267 (= W264), G268 (= G265), E282 (≠ R279), R285 (≠ S282), E337 (= E336)
Sites not aligning to the query:
5gsmA Glycoside hydrolase b with product
45% identity, 17% coverage: 33:134/611 of query aligns to 11:116/786 of 5gsmA
Sites not aligning to the query:
Q76HN4 Exo-beta-D-glucosaminidase; GlcNase; EC 3.2.1.- from Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) (Pyrococcus kodakaraensis (strain KOD1)) (see 2 papers)
45% identity, 17% coverage: 33:134/611 of query aligns to 11:116/786 of Q76HN4
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 178 D→N: Loss of activity.
- 178:179 binding
- 179 E→Q: Retains less than 3% of wild-type activity.
- 306 binding ; E→Q: Retains 40% of wild-type activity.
- 347 binding ; E→Q: Loss of activity.
- 379 binding
Q700S9 Beta-galactosidase A; Lactase A; EC 3.2.1.23 from Penicillium sp. (see paper)
26% identity, 51% coverage: 30:342/611 of query aligns to 50:384/1011 of Q700S9
- Y96 (= Y75) binding
- NAE 140:142 (≠ CAE 119:121) binding
- N199 (= N179) binding
- C205 (≠ Y184) modified: Disulfide link with 206
- C206 (≠ A185) modified: Disulfide link with 205
- C267 (≠ P226) modified: Disulfide link with 316
- C316 (≠ P272) modified: Disulfide link with 267
- Y365 (= Y324) binding
- N374 (= N333) modified: carbohydrate, N-linked (GlcNAc...) asparagine
Sites not aligning to the query:
- 456 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 625 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 707 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 763 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 780 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 917 modified: carbohydrate, N-linked (GlcNAc...) asparagine
1xc6A Native structure of beta-galactosidase from penicillium sp. In complex with galactose (see paper)
26% identity, 51% coverage: 30:342/611 of query aligns to 10:344/971 of 1xc6A
- binding beta-D-galactopyranose: Y56 (= Y75), N100 (≠ C119), A101 (= A120), E102 (= E121), E160 (= E180), Y221 (≠ H220), E259 (= E255), Y303 (= Y293), Y325 (= Y324)
- binding alpha-D-mannopyranose: E283 (≠ R279), R286 (≠ S282), E338 (= E336)
Sites not aligning to the query:
1tg7A Native structure of beta-galactosidase from penicillium sp. (see paper)
26% identity, 51% coverage: 30:342/611 of query aligns to 10:344/971 of 1tg7A
Sites not aligning to the query:
Query Sequence
>CA265_RS06080 FitnessBrowser__Pedo557:CA265_RS06080
MKVKLLWLVAMCFSLTAFGQQAKHTFKLGESDFLLDDKPFQIISGELHYPRVPKEAWRAR
MKMAKAMGLNTIGTYVFWNLHEPQKGKFDFSGNNNIAEFVKIAQQEGLWVILRPSPYVCA
EWEFGGYPYWLQNEKGLVVRSTEKQYLDEYKKYILEVGKQLASLQINHGGNIIMVQVENE
YGSYAADKNYLDINRKMFIEAGFDGLLYTCDPAADVKDGHLAGLLPAVNGIDDPAKIRQL
VNENHDGKGPYFIAEWYPAWFDWWGTAHHTVPAVQYTKRLDSVLAAGISINMYMFHGGTT
RGFMNGANYKDISPYEPQTSSYDYDAPLNEAGNVTEKFRAFRSVIEKHLPAGQSLPPIPA
AKPSIAIAPFKLTSKVTLFNALPKAVKNITPLTFEDLKQDYGYVLYRTTIQGGKKGQLQL
KQLRDYALIFINQKRAGILDRRLNQNTLSLDLPAGEVQLDIFVENMGRVNFGKYLLENKK
GITEQVTFNGAEVKNWSMYGFPFNNDRMTITSPSKSNGNGPTLQKGSFQIATVADTYLDM
TDWGKGVVWVNGHNLGKYWAIGPQQTLYVPQEWLKKGKNDITVLELLKPDQNILKAIDQP
ILNTLKKLNVD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory