SitesBLAST
Comparing CA265_RS06125 FitnessBrowser__Pedo557:CA265_RS06125 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0A6T3 Galactokinase; Galactose kinase; EC 2.7.1.6 from Escherichia coli (strain K12) (see 2 papers)
39% identity, 93% coverage: 21:378/383 of query aligns to 23:378/382 of P0A6T3
- Y371 (= Y371) mutation to H: Displays relaxed substrate specificity since it gains kinase activity toward sugars as diverse as D-galacturonic acid, D-talose, L-altrose, and L-glucose. Also shows enhanced turnover of the small pool of sugars converted by the wild-type enzyme.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
6q91A Structure of human galactokinase 1 bound with 5-chloro-n-isobutyl-2- methoxybenzamide
40% identity, 92% coverage: 7:360/383 of query aligns to 17:372/392 of 6q91A
- binding beta-D-galactopyranose: E43 (= E32), H44 (= H33), D46 (= D35), Y47 (= Y36), C182 (= C165), G183 (= G166), M185 (= M168), D186 (= D169), Y236 (= Y219), G346 (= G334)
- binding 2-(1,3-benzoxazol-2-ylamino)spiro[1,6,7,8-tetrahydroquinazoline-4,1'-cyclohexane]-5-one: R105 (≠ S86), W106 (= W87), Y109 (= Y90), S131 (≠ G114), L135 (= L118), G136 (= G119), S141 (= S124)
- binding 5-chloranyl-2-methoxy-~{N}-(2-methylpropyl)benzamide: L213 (= L196), S214 (≠ K197), D215 (≠ L198), L218 (≠ Y201), L295 (= L283), G298 (= G286), D299 (≠ N287), Y300 (≠ L288), F303 (≠ L291), L355 (≠ I343)
6q3xA Structure of human galactokinase in complex with galactose and 2'- (benzo[d]oxazol-2-ylamino)-7',8'-dihydro-1'h-spiro[cyclohexane-1,4'- quinazolin]-5'(6'h)-one (see paper)
40% identity, 92% coverage: 7:360/383 of query aligns to 18:373/393 of 6q3xA
- binding beta-D-galactopyranose: E44 (= E32), H45 (= H33), D47 (= D35), G184 (= G166), M186 (= M168), D187 (= D169), Y237 (= Y219), G347 (= G334)
- binding 2-(1,3-benzoxazol-2-ylamino)spiro[1,6,7,8-tetrahydroquinazoline-4,1'-cyclohexane]-5-one: Y110 (= Y90), L136 (= L118), S142 (= S124), S143 (= S125), L146 (≠ V128)
6qjeA Structure of human galactokinase 1 bound with 4-{[2-(methylsulfonyl)- 1h-imidazol-1-yl]methyl}-1,3-thiazole
40% identity, 92% coverage: 7:360/383 of query aligns to 15:370/390 of 6qjeA
- binding beta-D-galactopyranose: E41 (= E32), H42 (= H33), D44 (= D35), Y45 (= Y36), G181 (= G166), M183 (= M168), D184 (= D169), Y234 (= Y219), G344 (= G334)
- binding 2-(1,3-benzoxazol-2-ylamino)spiro[1,6,7,8-tetrahydroquinazoline-4,1'-cyclohexane]-5-one: S77 (= S68), Y107 (= Y90), V127 (≠ I112), S129 (≠ G114), L133 (= L118), S139 (= S124), S140 (= S125), R226 (≠ K211)
- binding 4-[(2-methylsulfonylimidazol-1-yl)methyl]-1,3-thiazole: R103 (≠ S86), A176 (= A161), G177 (= G162)
7s4cA Crystal structure of inhibitor-bound galactokinase (see paper)
40% identity, 92% coverage: 7:360/383 of query aligns to 16:371/391 of 7s4cA
- binding alpha-D-galactopyranose: E42 (= E32), H43 (= H33), D45 (= D35), Y46 (= Y36), G182 (= G166), D185 (= D169), Y235 (= Y219), G345 (= G334)
- binding phosphate ion: G135 (= G119), G137 (= G121), S139 (= S123), S140 (= S124), S141 (= S125), Q171 (≠ K155), H174 (≠ Q158), H362 (≠ D351), H366 (≠ E355), E369 (≠ S358)
- binding 2-({(4R)-4-(2-chlorophenyl)-2-[(6-fluoro-1,3-benzoxazol-2-yl)amino]-6-methyl-1,4-dihydropyrimidine-5-carbonyl}amino)pyridine-4-carboxylic acid: M54 (≠ A44), D82 (vs. gap), R104 (≠ S86), W105 (= W87), Y108 (= Y90), L134 (= L118), S140 (= S124), L144 (≠ V128), K194 (= K178), L212 (= L196), D214 (≠ L198), L217 (≠ Y201), A218 (≠ K202), V219 (≠ L203), L294 (= L283), F302 (≠ L291), L354 (≠ I343)
Sites not aligning to the query:
7s49A Crystal structure of inhibitor-bound galactokinase (see paper)
40% identity, 92% coverage: 7:360/383 of query aligns to 16:371/391 of 7s49A
- binding (4R)-2-[(1,3-benzoxazol-2-yl)amino]-4-(4-chloro-1H-pyrazol-5-yl)-4,6,7,8-tetrahydroquinazolin-5(1H)-one: S78 (= S68), D82 (vs. gap), R104 (≠ S86), W105 (= W87), Y108 (= Y90), V128 (≠ I112), L134 (= L118), S140 (= S124), S141 (= S125), L144 (≠ V128), R227 (≠ K211)
- binding alpha-D-galactopyranose: E42 (= E32), H43 (= H33), D45 (= D35), Y46 (= Y36), G182 (= G166), D185 (= D169), Y235 (= Y219)
- binding phosphate ion: G135 (= G119), G137 (= G121), S139 (= S123), S140 (= S124), S141 (= S125), Q171 (≠ K155), H174 (≠ Q158), H362 (≠ D351), H366 (≠ E355)
7rclA Crystal structure of adp-bound galactokinase (see paper)
40% identity, 92% coverage: 7:360/383 of query aligns to 16:371/391 of 7rclA
- binding adenosine-5'-diphosphate: T76 (≠ S66), S78 (= S68), W105 (= W87), Y108 (= Y90), G135 (= G119), G137 (= G121), S139 (= S123), S140 (= S124), S141 (= S125), L144 (≠ V128), H228 (= H212)
- binding alpha-D-galactopyranose: E42 (= E32), H43 (= H33), D45 (= D35), Y46 (= Y36), C181 (= C165), G182 (= G166), M184 (= M168), D185 (= D169), Y235 (= Y219)
- binding phosphate ion: H362 (≠ D351), H366 (≠ E355)
7ozxB Structure of human galactokinase 1 bound with azepan-1-yl(2,6- difluorophenyl)methanone
40% identity, 92% coverage: 7:360/383 of query aligns to 16:371/391 of 7ozxB
- binding beta-D-galactopyranose: E42 (= E32), H43 (= H33), D45 (= D35), Y46 (= Y36), G182 (= G166), M184 (= M168), D185 (= D169), Y235 (= Y219), G345 (= G334)
- binding 2-(1,3-benzoxazol-2-ylamino)spiro[1,6,7,8-tetrahydroquinazoline-4,1'-cyclohexane]-5-one: S78 (= S68), D82 (vs. gap), R104 (≠ S86), Y108 (= Y90), S130 (≠ G114), L134 (= L118), S140 (= S124), S141 (= S125), L144 (≠ V128)
- binding (azepan-1-yl)(2,6-difluorophenyl)methanone: S32 (≠ R22)
Sites not aligning to the query:
6zgyA Structure of human galactokinase 1 bound with 2-(4-chlorophenyl)-n- (pyrimidin-2-yl)acetamide (see paper)
40% identity, 92% coverage: 7:360/383 of query aligns to 16:371/391 of 6zgyA
- binding beta-D-galactopyranose: E42 (= E32), H43 (= H33), D45 (= D35), Y46 (= Y36), G182 (= G166), M184 (= M168), D185 (= D169), Y235 (= Y219)
- binding 2-(1,3-benzoxazol-2-ylamino)spiro[1,6,7,8-tetrahydroquinazoline-4,1'-cyclohexane]-5-one: D82 (vs. gap), R104 (≠ S86), W105 (= W87), V128 (≠ I112), S130 (≠ G114), L134 (= L118), S140 (= S124), L144 (≠ V128)
- binding (2,5-dimethylphenyl) pyridine-4-carboxylate: L212 (= L196), D214 (≠ L198), L217 (≠ Y201), L294 (= L283), F302 (≠ L291), L354 (≠ I343)
6zh0A Structure of human galactokinase 1 bound with 2-(4-chlorophenyl)-n- (pyrimidin-2-yl)acetamide (see paper)
39% identity, 98% coverage: 7:382/383 of query aligns to 16:388/390 of 6zh0A
- binding beta-D-galactopyranose: R36 (= R26), E42 (= E32), H43 (= H33), D45 (= D35), G182 (= G166), M184 (= M168), D185 (= D169), Y235 (= Y219), G345 (= G334)
- binding 2-(1,3-benzoxazol-2-ylamino)spiro[1,6,7,8-tetrahydroquinazoline-4,1'-cyclohexane]-5-one: D82 (vs. gap), R104 (≠ S86), W105 (= W87), L134 (= L118), S140 (= S124), L144 (≠ V128)
- binding N-(3-chlorophenyl)-2,2,2-trifluoroacetamide: L212 (= L196), L294 (= L283), G297 (= G286), D298 (≠ N287), Y299 (≠ L288), F302 (≠ L291), L354 (≠ I343)
6q8zA Structure of human galactokinase 1 bound with n-(cyclobutylmethyl)-1, 5-dimethyl-1h-pyrazole-4-carboxamide
40% identity, 92% coverage: 7:360/383 of query aligns to 17:372/392 of 6q8zA
- binding beta-D-galactopyranose: E43 (= E32), H44 (= H33), D46 (= D35), Y47 (= Y36), G183 (= G166), M185 (= M168), D186 (= D169), Y236 (= Y219), G345 (= G333), G346 (= G334)
- binding 2-(1,3-benzoxazol-2-ylamino)spiro[1,6,7,8-tetrahydroquinazoline-4,1'-cyclohexane]-5-one: R105 (≠ S86), Y109 (= Y90), V129 (≠ I112), L135 (= L118), G136 (= G119), S141 (= S124), S142 (= S125)
- binding ~{N}-(cyclobutylmethyl)-1,5-dimethyl-pyrazole-4-carboxamide: A31 (vs. gap), V32 (= V21), S33 (≠ R22)
Sites not aligning to the query:
6q3wC Structure of human galactokinase 1 bound with ethyl 1-(2-pyrazinyl)-4- piperidinecarboxylate
40% identity, 92% coverage: 7:360/383 of query aligns to 16:370/390 of 6q3wC
- binding beta-D-galactopyranose: E42 (= E32), H43 (= H33), D45 (= D35), Y46 (= Y36), G182 (= G166), M184 (= M168), D185 (= D169), Y235 (= Y219), G344 (= G334)
- binding 2-(1,3-benzoxazol-2-ylamino)spiro[1,6,7,8-tetrahydroquinazoline-4,1'-cyclohexane]-5-one: D82 (vs. gap), R104 (≠ S86), W105 (= W87), Y108 (= Y90), V128 (≠ I112), S130 (≠ G114), L134 (= L118), S140 (= S124), S141 (= S125), R227 (≠ K211)
- binding ethyl 1-pyrazin-2-ylpiperidine-4-carboxylate: R104 (≠ S86), N107 (= N89), Y108 (= Y90), A177 (= A161), G178 (= G162)
6q90C Structure of human galactokinase 1 bound with 1-(4-methoxyphenyl)-3- (4-pyridinyl)urea
40% identity, 92% coverage: 7:360/383 of query aligns to 17:371/391 of 6q90C
- binding beta-D-galactopyranose: E43 (= E32), H44 (= H33), D46 (= D35), Y47 (= Y36), G182 (= G166), D185 (= D169)
- binding 2-(1,3-benzoxazol-2-ylamino)spiro[1,6,7,8-tetrahydroquinazoline-4,1'-cyclohexane]-5-one: R104 (≠ S86), W105 (= W87), Y108 (= Y90), L134 (= L118), S140 (= S124), L144 (≠ V128)
- binding N-(4-methoxyphenyl)-N'-pyridin-4-ylurea: L212 (= L196), D214 (≠ L198), P215 (≠ D199), L217 (≠ Y201), L354 (≠ I343)
Sites not aligning to the query:
1wuuA Crystal structure of human galactokinase complexed with mgamppnp and galactose (see paper)
40% identity, 92% coverage: 7:360/383 of query aligns to 18:371/391 of 1wuuA
- binding phosphoaminophosphonic acid-adenylate ester: T78 (≠ S66), S80 (= S68), W107 (= W87), Y110 (= Y90), L136 (= L118), G137 (= G119), G139 (= G121), S141 (= S123), S142 (= S124), S143 (= S125), L146 (≠ V128)
- binding alpha-D-galactopyranose: E44 (= E32), H45 (= H33), D47 (= D35), Y48 (= Y36), G184 (= G166), M186 (= M168), D187 (= D169), Y235 (= Y219)
6zgvD Structure of human galactokinase 1 bound with 2-(4-chlorophenyl)-n- (pyrimidin-2-yl)acetamide (see paper)
40% identity, 92% coverage: 7:360/383 of query aligns to 10:352/372 of 6zgvD
6zfhA Structure of human galactokinase in complex with galactose and 2'- (benzo[d]oxazol-2-ylamino)-7',8'-dihydro-1'h-spiro[cyclopentane-1,4'- quinazolin]-5'(6'h)-one (see paper)
39% identity, 92% coverage: 7:360/383 of query aligns to 15:366/386 of 6zfhA
- binding beta-D-galactopyranose: E41 (= E32), H42 (= H33), D44 (= D35), G181 (= G166), M183 (= M168), D184 (= D169), Y230 (= Y219), G340 (= G334)
- binding 2-(1,3-benzoxazol-2-ylamino)spiro[1,6,7,8-tetrahydroquinazoline-4,1'-cyclopentane]-5-one: W104 (= W87), Y107 (= Y90), L133 (= L118), S139 (= S124), S140 (= S125), L143 (≠ V128)
2deiA Crystal structure of galaktokinase from pyrococcus horikoshii with amp-pnp and galactose
39% identity, 95% coverage: 19:381/383 of query aligns to 2:350/350 of 2deiA
- binding alpha-D-galactopyranose: E15 (= E32), H16 (= H33), D18 (= D35), G146 (= G166), D149 (= D169), Y198 (= Y219)
- binding magnesium-5'-adenyly-imido-triphosphate: S47 (= S66), F50 (≠ Y69), W67 (= W87), Y70 (= Y90), L98 (= L118), G99 (= G119), G101 (= G121), S103 (= S123), S104 (= S124), S105 (= S125), F108 (≠ V128)
6gr2A Structure of human galactokinase in complex with galactose and adp
39% identity, 92% coverage: 7:360/383 of query aligns to 14:363/383 of 6gr2A
- binding adenosine-5'-diphosphate: T74 (≠ S66), S76 (= S68), Y106 (= Y90), L132 (= L118), G133 (= G119), G135 (= G121), S137 (= S123), S138 (= S124), S139 (= S125)
- binding beta-D-galactopyranose: E40 (= E32), H41 (= H33), D43 (= D35), G180 (= G166), D183 (= D169), Y227 (= Y219)
6zgwD Structure of human galactokinase 1 bound with (4-chlorophenyl)methyl pyridine-3-carboxylate (see paper)
39% identity, 92% coverage: 7:360/383 of query aligns to 11:351/371 of 6zgwD
Sites not aligning to the query:
6zgzD Structure of human galactokinase 1 bound with 2-(4-chlorophenyl)-n- (pyrimidin-2-yl)acetamide (see paper)
39% identity, 92% coverage: 7:360/383 of query aligns to 11:348/368 of 6zgzD
Query Sequence
>CA265_RS06125 FitnessBrowser__Pedo557:CA265_RS06125
MNAQHLKNTFKKLFNAEPILVRSPGRINIIGEHTDYNGGFVMPAAIDKAIYVAISKRGDD
EIHLFSESYQQFDISSINSLKKSENSWANYILGIADQLKERGYQLGGFNFYIDGDVPLGA
GLSSSAAVECATGFALDQLFSLSVSRMDIALIAQKAEQTFAGVNCGIMDQFASVFGKKDQ
AIMLDCRSMKHIYIPLKLDGYKLLLLNTNVKHALADSAYNKRRSQCEQGVAWVKAHYPNV
STLRDVDLTMLETYVKPMDLEVYNKCRFVVEEIGRLLTAAEQLENGNLQALGKLMFETHE
GLSKDYEVSCKELDFLVEAVKPLDYVLGARMMGGGFGGCTINIVKEEKIADLVEELSSKY
LLQFGLKLDSYTVQTDNGTSLFN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory