SitesBLAST
Comparing CA265_RS07220 FitnessBrowser__Pedo557:CA265_RS07220 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4wuvA Crystal structure of a putative d-mannonate oxidoreductase from haemophilus influenza (avi_5165, target efi-513796) with bound NAD
40% identity, 97% coverage: 10:274/274 of query aligns to 7:280/280 of 4wuvA
- binding nicotinamide-adenine-dinucleotide: G17 (= G20), G20 (= G23), V21 (= V24), L22 (= L25), D41 (≠ G44), L42 (≠ R45), T66 (≠ A69), N67 (≠ D70), V68 (= V71), G94 (≠ A97), G96 (= G99), L134 (= L127), I161 (= I153), Y176 (= Y168), K180 (= K172)
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
32% identity, 96% coverage: 8:270/274 of query aligns to 1:251/252 of 1vl8B
- active site: G17 (≠ V24), S143 (= S155), I154 (≠ V165), Y157 (= Y168), K161 (= K172)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G20), R16 (≠ G23), G17 (≠ V24), L18 (= L25), S37 (≠ G44), R38 (= R45), C63 (≠ A69), D64 (= D70), V65 (= V71), A91 (= A97), A92 (= A98), G93 (= G99), I94 (≠ G100), V114 (≠ L127), I141 (= I153), S143 (= S155), Y157 (= Y168), K161 (= K172), P187 (= P201), G188 (= G202), Y190 (≠ F204), T192 (= T206), M194 (≠ Q208), T195 (≠ N209)
7v0hG Crystal structure of putative glucose 1-dehydrogenase from burkholderia cenocepacia in complex with NADP and a potential reaction product
33% identity, 96% coverage: 6:268/274 of query aligns to 4:252/253 of 7v0hG
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G20), S20 (≠ T22), K21 (≠ G23), G22 (≠ V24), I23 (≠ L25), A43 (≠ E48), S44 (≠ I49), S45 (≠ A50), G68 (≠ A69), D69 (= D70), V70 (= V71), N96 (≠ A97), S97 (≠ A98), G98 (= G99), Y100 (≠ Q108), I144 (= I153), S146 (= S155), Y159 (= Y168), K163 (= K172), P189 (= P201), G190 (= G202), M191 (≠ F203), I192 (≠ F204), T194 (= T206), G196 (vs. gap), T197 (≠ Q208)
- binding (2R)-2-(hydroxymethyl)pentanedioic acid: S146 (= S155), Y159 (= Y168), M191 (≠ F203), I202 (≠ L213)
3uf0A Crystal structure of a putative NAD(p) dependent gluconate 5- dehydrogenase from beutenbergia cavernae(efi target efi-502044) with bound NADP (low occupancy)
30% identity, 96% coverage: 9:270/274 of query aligns to 3:248/249 of 3uf0A
- active site: G18 (≠ V24), S141 (= S155), V151 (= V165), Y154 (= Y168), K158 (= K172)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G20), S17 (≠ G23), G18 (≠ V24), I19 (≠ L25), R39 (= R45), D63 (= D70), L64 (≠ V71), N89 (≠ A97), G91 (= G99), I92 (≠ N101), I139 (= I153), A140 (≠ S154), S141 (= S155), Y154 (= Y168), K158 (= K172), P184 (= P201), G185 (= G202), V187 (≠ F204), T189 (= T206), N191 (≠ Q208), T192 (≠ N209)
4za2D Crystal structure of pectobacterium carotovorum 2-keto-3-deoxy-d- gluconate dehydrogenase complexed with NAD+ (see paper)
31% identity, 96% coverage: 9:270/274 of query aligns to 6:246/247 of 4za2D
- binding nicotinamide-adenine-dinucleotide: G17 (= G20), D19 (≠ T22), L22 (= L25), I42 (≠ E47), D65 (= D70), M66 (≠ V71), N92 (≠ A97), A93 (= A98), G94 (= G99), L115 (= L127), I143 (= I153), S145 (= S155), Y158 (= Y168), K162 (= K172), G189 (= G202), M191 (≠ F204), T193 (= T206), N195 (≠ Q208)
5u9pB Crystal structure of a gluconate 5-dehydrogenase from burkholderia cenocepacia j2315 in complex with NADP and tartrate
33% identity, 96% coverage: 9:270/274 of query aligns to 12:259/261 of 5u9pB
- active site: G27 (≠ V24), S152 (= S155), Y165 (= Y168), K169 (= K172)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G23 (= G20), R26 (≠ G23), G27 (≠ V24), I28 (≠ L25), R48 (= R45), D73 (= D70), V74 (= V71), N100 (≠ A97), A101 (= A98), I150 (= I153), Y165 (= Y168), K169 (= K172), P195 (= P201), F198 (= F204), T200 (= T206), L202 (≠ Q208), N203 (= N209)
4hp8B Crystal structure of a putative 2-deoxy-d-gluconate 3-dehydrogenase from agrobacterium tumefaciens (target efi-506435) with bound NADP
34% identity, 96% coverage: 9:270/274 of query aligns to 4:245/246 of 4hp8B
- active site: G19 (≠ V24), S138 (= S155), V148 (= V165), Y151 (= Y168), K155 (= K172)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G20), N17 (≠ T22), T18 (≠ G23), G19 (≠ V24), L20 (= L25), R40 (= R45), R41 (≠ N46), D63 (= D70), F64 (≠ V71), N85 (≠ A97), G87 (= G99), I88 (= I107), I136 (= I153), Y151 (= Y168), K155 (= K172), P181 (= P201), G182 (= G202), I184 (≠ F204), T186 (= T206), N188 (≠ Q208), T189 (≠ N209)
8hsaA Brucella melitensis 7-alpha-hydroxysteroid dehydrogenase mutant: 1-53 truncation/m196i/i258m/k262t-NAD+
32% identity, 95% coverage: 7:267/274 of query aligns to 1:245/248 of 8hsaA
- binding nicotinamide-adenine-dinucleotide: G14 (= G20), I19 (≠ L25), D38 (≠ G44), L39 (≠ R45), C63 (≠ A69), N64 (≠ D70), V65 (= V71), N91 (≠ A97), A92 (= A98), G93 (= G99), I140 (= I153), S141 (= S154), Y155 (= Y168), K159 (= K172), P185 (= P201), G186 (= G202)
1ahhA 7 alpha-hydroxysteroid dehydrogenase complexed with NAD+ (see paper)
30% identity, 95% coverage: 9:267/274 of query aligns to 7:249/253 of 1ahhA
- active site: G22 (≠ V24), S146 (= S155), M156 (≠ V165), Y159 (= Y168), K163 (= K172)
- binding nicotinamide-adenine-dinucleotide: G18 (= G20), A21 (≠ G23), D42 (≠ G44), I43 (≠ R45), C67 (≠ A69), D68 (= D70), I69 (≠ V71), N95 (≠ A97), G97 (= G99), T145 (≠ S154), Y159 (= Y168), K163 (= K172), P189 (= P201), G190 (= G202), I192 (≠ F204)
1ahiA 7 alpha-hydroxysteroid dehydrogenase complexed with nadh and 7-oxo glycochenodeoxycholic acid (see paper)
30% identity, 95% coverage: 9:267/274 of query aligns to 7:249/255 of 1ahiA
- active site: G22 (≠ V24), S146 (= S155), M156 (≠ V165), Y159 (= Y168), K163 (= K172)
- binding glycochenodeoxycholic acid: S146 (= S155), A148 (≠ S157), N151 (≠ Q160), Y159 (= Y168), A196 (≠ Q208), V200 (≠ L212)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G18 (= G20), A21 (≠ G23), G22 (≠ V24), I23 (≠ L25), D42 (≠ G44), I43 (≠ R45), D68 (= D70), I69 (≠ V71), N95 (≠ A97), Y159 (= Y168), K163 (= K172), P189 (= P201), G190 (= G202), I192 (≠ F204), T194 (= T206), A196 (≠ Q208)
Sites not aligning to the query:
P0AET8 7alpha-hydroxysteroid dehydrogenase; 7alpha-HSDH; NAD-dependent 7alpha-hydroxysteroid dehydrogenase; EC 1.1.1.159 from Escherichia coli (strain K12) (see 2 papers)
30% identity, 95% coverage: 9:267/274 of query aligns to 7:249/255 of P0AET8
- I23 (≠ L25) binding
- DI 42:43 (≠ GR 44:45) binding
- DI 68:69 (≠ DV 70:71) binding
- N95 (≠ A97) binding
- G99 (≠ N101) binding
- S146 (= S155) binding ; mutation S->A,H: Reduction of the catalytic efficiency by over 65%. No effect on the affinity for cholate and NAD.
- N151 (≠ Q160) binding
- Y159 (= Y168) binding ; binding ; mutation to F: Loss of activity.; mutation to H: Reduction of the catalytic efficiency by 87.7%. No effect on the affinity for cholate and NAD.
- K163 (= K172) binding ; mutation to I: Reduction of the catalytic efficiency by 95%. No effect on the affinity for cholate and NAD.; mutation to R: Reduction of the catalytic efficiency by 35%. No effect on the affinity for cholate and NAD.
- ILT 192:194 (≠ FIT 204:206) binding
1xhlB Crystal structure of putative tropinone reductase-ii from caenorhabditis elegans with cofactor and substrate
32% identity, 95% coverage: 14:274/274 of query aligns to 5:264/274 of 1xhlB
- active site: G15 (≠ V24), F24 (≠ L33), Q30 (≠ A39), N90 (= N96), S144 (= S155), Q150 (= Q160), Y155 (≠ V165), Y158 (= Y168), K162 (= K172), E203 (= E216)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (= G20), S13 (≠ T22), G15 (≠ V24), I16 (≠ L25), R36 (= R45), N37 (= N46), R40 (≠ I49), D64 (= D70), V65 (= V71), N91 (≠ A97), G93 (= G99), L116 (= L127), S144 (= S155), Y158 (= Y168), K162 (= K172), P188 (= P201), G189 (= G202), A190 (≠ F203), V191 (≠ F204), T193 (= T206), G194 (≠ N207), F195 (≠ Q208)
- binding 8-methyl-8-azabicyclo[3,2,1]octan-3-one: A190 (≠ F203), F195 (≠ Q208)
1xhlA Crystal structure of putative tropinone reductase-ii from caenorhabditis elegans with cofactor and substrate
32% identity, 95% coverage: 14:274/274 of query aligns to 5:264/274 of 1xhlA
- active site: G15 (≠ V24), F24 (≠ L33), Q30 (≠ A39), N90 (= N96), S144 (= S155), Q150 (= Q160), Y155 (≠ V165), Y158 (= Y168), K162 (= K172), E203 (= E216)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (= G20), S13 (≠ T22), G15 (≠ V24), I16 (≠ L25), R36 (= R45), N37 (= N46), R40 (≠ I49), D64 (= D70), V65 (= V71), N91 (≠ A97), A92 (= A98), G93 (= G99), L116 (= L127), S144 (= S155), K162 (= K172), P188 (= P201), G189 (= G202), V191 (≠ F204), T193 (= T206), G194 (≠ N207), F195 (≠ Q208)
3o03A Quaternary complex structure of gluconate 5-dehydrogenase from streptococcus suis type 2 (see paper)
33% identity, 97% coverage: 9:273/274 of query aligns to 7:251/254 of 3o03A
- active site: G22 (≠ V24), S147 (= S155), V157 (= V165), Y160 (= Y168), K164 (= K172)
- binding calcium ion: S147 (= S155), M148 (≠ V156), P190 (= P201)
- binding D-gluconic acid: I99 (≠ Q108), R101 (≠ G110), S147 (= S155), M149 (≠ S157), R154 (≠ L162), Y160 (= Y168)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G20), Y21 (≠ G23), G22 (≠ V24), I23 (≠ L25), D42 (≠ G44), I43 (≠ R45), L47 (≠ I49), D68 (= D70), V69 (= V71), N95 (≠ A97), A96 (= A98), G97 (= G99), I145 (= I153), Y160 (= Y168), K164 (= K172), P190 (= P201)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
32% identity, 95% coverage: 11:270/274 of query aligns to 3:247/248 of 6ixmC
- active site: G16 (≠ V24), S142 (= S155), Y155 (= Y168), K159 (= K172)
- binding nicotinamide-adenine-dinucleotide: G12 (= G20), S15 (≠ G23), G16 (≠ V24), I17 (≠ L25), D36 (≠ G44), I37 (≠ R45), A61 (= A69), D62 (= D70), T63 (≠ V71), N89 (≠ A97), A90 (= A98), M140 (≠ I153), S142 (= S155), Y155 (= Y168), K159 (= K172), P185 (= P201), A186 (≠ G202), Y187 (≠ F203), I188 (≠ F204), L192 (= L212)
4iqgD Crystal structure of bpro0239 oxidoreductase from polaromonas sp. Js666 in NADP bound form
31% identity, 93% coverage: 13:267/274 of query aligns to 2:247/248 of 4iqgD
- active site: G13 (≠ V24), N112 (= N128), S143 (= S155), Y154 (≠ V165), Y157 (= Y168), K161 (= K172)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G9 (= G20), S11 (≠ T22), R12 (≠ G23), G13 (≠ V24), I14 (≠ L25), N32 (vs. gap), A34 (≠ G44), S35 (≠ R45), N36 (= N46), A59 (= A69), D60 (= D70), V61 (= V71), N87 (≠ A97), A88 (= A98), G89 (= G99), V141 (≠ I153), S143 (= S155), Y157 (= Y168), K161 (= K172), P187 (= P201), G188 (= G202), I190 (≠ F204), T192 (= T206), I194 (≠ T214), H195 (≠ N215)
Q9L9F8 Short-chain reductase protein NovJ; Novobiocin biosynthesis protein J; EC 1.1.1.- from Streptomyces niveus (Streptomyces spheroides) (see paper)
33% identity, 93% coverage: 12:267/274 of query aligns to 15:260/262 of Q9L9F8
- S152 (= S155) mutation to A: 2-3-fold decrease in beta-ketotyrosine product formation.
- Y164 (= Y168) mutation to F: 50-fold reduction in catalytic activity.
- K168 (= K172) mutation to I: Does not alter the catalytic turnover.
P73574 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-acyl carrier protein reductase; EC 1.1.1.100 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
31% identity, 96% coverage: 8:271/274 of query aligns to 1:247/247 of P73574
- A14 (= A21) mutation to G: 4.2-fold increase in activity on acetoacetyl-CoA.
- P151 (≠ T163) mutation to F: 2.7-fold increase in activity on acetoacetyl-CoA.; mutation to V: 5.7-fold increase in activity on acetoacetyl-CoA.
- K160 (= K172) mutation to A: Almost no activity on acetoacetyl-CoA.
- F188 (= F203) mutation to Y: 3.3-fold increase in activity on acetoacetyl-CoA.
- N198 (≠ R223) mutation to R: 3.5-fold increase in activity on acetoacetyl-CoA.
G9FRD7 7alpha-hydroxysteroid dehydrogenase; 7alpha-HSDH; NADP-dependent 7alpha-hydroxysteroid dehydrogenase; EC 1.1.1.- from Clostridium sardiniense (Clostridium absonum) (see 2 papers)
31% identity, 94% coverage: 11:268/274 of query aligns to 4:249/262 of G9FRD7
- SSTRGI 13:18 (≠ GATGVL 20:25) binding
- R38 (= R45) binding ; mutation to D: Loss of catalytic activity.
- NA 63:64 (≠ DV 70:71) binding
- N90 (≠ A97) binding
- T145 (≠ S155) binding
- Y158 (= Y168) binding ; binding
- K162 (= K172) binding
- IGT---RA 191:195 (≠ FITNQNRA 204:211) binding
Sites not aligning to the query:
- 261:262 mutation Missing: 5-fold reduction in catalytic efficiency.
5epoA The three-dimensional structure of clostridium absonum 7alpha- hydroxysteroid dehydrogenase (see paper)
31% identity, 94% coverage: 11:268/274 of query aligns to 3:248/261 of 5epoA
- active site: G16 (≠ V24), T144 (≠ S155), I152 (≠ T163), Y157 (= Y168), K161 (= K172), R193 (= R210)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S12 (≠ G20), T14 (= T22), R15 (≠ G23), G16 (≠ V24), I17 (≠ L25), R37 (= R45), F61 (≠ A69), N62 (≠ D70), N89 (≠ A97), Y90 (≠ A98), G91 (= G99), Y157 (= Y168), K161 (= K172), P187 (= P201), G188 (= G202), I190 (≠ F204), T192 (= T206), R193 (= R210), A194 (= A211), A195 (≠ L212)
- binding taurochenodeoxycholic acid: T93 (vs. gap), T144 (≠ S155), G146 (≠ S157), R154 (≠ V165), Y157 (= Y168), G188 (= G202), N198 (= N215), M199 (≠ E216), F203 (≠ L220)
Query Sequence
>CA265_RS07220 FitnessBrowser__Pedo557:CA265_RS07220
MVKEVESLFSLKNKVVVVTGATGVLGEAFINGLCAAGAAIVVIGRNEEIAKQRAEDVIKA
GGKAIYIIADVLNEQNLIDANVTIIKEFGRIDALVNAAGGNVAEAVIQPGSDVFDLNVPA
LKQAFDLNLFGTIMPTQIFGKEIAKNGGSIVNISSVSATQALTRVLGYSLAKAAIDSYTK
WMAVELANRYQDKIRMNAIVPGFFITNQNRALLTNEDGSLTARGQAIISKTPFKRFGAPE
ELIGALVYLLSDASKFVNGENVKVDGGFTAFSGV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory