Comparing CA265_RS07485 CA265_RS07485 macrolide ABC transporter ATP-binding protein to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
57% identity, 88% coverage: 3:225/252 of query aligns to 1:223/226 of 5xu1B
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
48% identity, 91% coverage: 5:233/252 of query aligns to 3:231/592 of 5lj7A
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
48% identity, 91% coverage: 5:233/252 of query aligns to 3:231/615 of 5lilA
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
49% identity, 88% coverage: 5:225/252 of query aligns to 1:226/232 of 1f3oA
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
45% identity, 98% coverage: 4:251/252 of query aligns to 3:250/648 of P75831
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
49% identity, 88% coverage: 5:225/252 of query aligns to 1:226/230 of 1l2tA
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
46% identity, 90% coverage: 2:228/252 of query aligns to 1:227/650 of 5ws4A
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
46% identity, 87% coverage: 1:220/252 of query aligns to 1:221/233 of P75957
7mdyC Lolcde nucleotide-bound
46% identity, 86% coverage: 5:220/252 of query aligns to 2:218/226 of 7mdyC
7arlD Lolcde in complex with lipoprotein and adp (see paper)
46% identity, 86% coverage: 5:220/252 of query aligns to 2:218/222 of 7arlD
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
46% identity, 87% coverage: 3:220/252 of query aligns to 2:220/229 of 7v8iD
2pclA Crystal structure of abc transporter with complex (aq_297) from aquifex aeolicus vf5
45% identity, 83% coverage: 13:220/252 of query aligns to 10:214/223 of 2pclA
8g4cB Bceabs atpgs high res tm (see paper)
44% identity, 78% coverage: 25:220/252 of query aligns to 23:219/248 of 8g4cB
Sites not aligning to the query:
7tchB Bceab e169q variant atp-bound conformation (see paper)
43% identity, 78% coverage: 25:220/252 of query aligns to 22:218/245 of 7tchB
Sites not aligning to the query:
8iddA Cryo-em structure of mycobacterium tuberculosis atp bound ftsex/ripc complex in peptidisc (see paper)
42% identity, 88% coverage: 5:225/252 of query aligns to 2:220/225 of 8iddA
8igqA Cryo-em structure of mycobacterium tuberculosis adp bound ftsex/ripc complex in peptidisc (see paper)
42% identity, 88% coverage: 5:225/252 of query aligns to 2:220/227 of 8igqA
A5U7B7 Cell division ATP-binding protein FtsE from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) (see 2 papers)
42% identity, 88% coverage: 5:225/252 of query aligns to 1:219/229 of A5U7B7
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
41% identity, 81% coverage: 5:209/252 of query aligns to 1:205/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
41% identity, 81% coverage: 5:209/252 of query aligns to 2:206/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
41% identity, 81% coverage: 5:209/252 of query aligns to 2:206/344 of 3tuiC
>CA265_RS07485 CA265_RS07485 macrolide ABC transporter ATP-binding protein
MEKPLITIKEIGRKYVIGSEVIHALKSVSLDINKGEFVALMGPSGSGKSTLMNILGCLDT
PSSGTYVLNGTNVSHMSDDALAEVRNQEIGFVFQTFNLLPRSTSLDNVALPLIYAGTSKK
DRDARAARALENVGLGNRMDHKPNELSGGQRQRVAVARALINNPSIILADEPTGNLDTKT
SIEIMGLLEEIHSKGNTIILVTHEEDIAQHAHRIVRMRDGLIENDYLNTDIKNVSPRLQA
LKDNGSDWEKIN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory