SitesBLAST
Comparing CA265_RS07530 FitnessBrowser__Pedo557:CA265_RS07530 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6zhkA Crystal structure of adenosylmethionine-8-amino-7-oxononanoate aminotransferase from methanocaldococcus jannaschii dsm 2661
39% identity, 97% coverage: 15:432/433 of query aligns to 3:435/438 of 6zhkA
1mlzA Crystal structure of 7,8-diaminopelargonic acid synthase in complex with the trans-isomer of amiclenomycin. (see paper)
38% identity, 95% coverage: 20:432/433 of query aligns to 9:422/427 of 1mlzA
- active site: Y17 (= Y28), Y144 (= Y155), E210 (= E212), D244 (= D246), A247 (≠ M249), K273 (= K275), Y397 (= Y407)
- binding pyridoxal-5'-phosphate: G112 (= G123), S113 (= S124), Y144 (= Y155), H145 (= H156), D244 (= D246), I246 (≠ V248), K273 (= K275), P307 (≠ H310), T308 (≠ S311)
- binding trans-amiclenomycin: W52 (= W63), W53 (= W64), Y144 (= Y155), K273 (= K275), R390 (= R400), F392 (≠ L402)
1mlyA Crystal structure of 7,8-diaminopelargonic acid synthase in complex with the cis isomer of amiclenomycin (see paper)
38% identity, 95% coverage: 20:432/433 of query aligns to 9:422/427 of 1mlyA
- active site: Y17 (= Y28), Y144 (= Y155), E210 (= E212), D244 (= D246), A247 (≠ M249), K273 (= K275), Y397 (= Y407)
- binding cis-amiclenomycin: W52 (= W63), W53 (= W64), K273 (= K275), R390 (= R400), F392 (≠ L402)
- binding pyridoxal-5'-phosphate: G112 (= G123), S113 (= S124), Y144 (= Y155), H145 (= H156), D244 (= D246), I246 (≠ V248), K273 (= K275), P307 (≠ H310), T308 (≠ S311)
1qj3A Crystal structure of 7,8-diaminopelargonic acid synthase in complex with 7-keto-8-aminopelargonic acid (see paper)
38% identity, 95% coverage: 20:432/433 of query aligns to 9:411/416 of 1qj3A
- active site: Y17 (= Y28), Y144 (= Y155), E201 (= E212), D235 (= D246), A238 (≠ M249), K264 (= K275), Y386 (= Y407)
- binding 7-keto-8-aminopelargonic acid: Y17 (= Y28), W52 (= W63), Y144 (= Y155), K264 (= K275), R379 (= R400), F381 (≠ L402)
- binding pyridoxal-5'-phosphate: G112 (= G123), S113 (= S124), Y144 (= Y155), H145 (= H156), G146 (= G157), D235 (= D246), I237 (≠ V248), A238 (≠ M249), K264 (= K275)
6erkA Crystal structure of diaminopelargonic acid aminotransferase from psychrobacter cryohalolentis (see paper)
40% identity, 92% coverage: 20:419/433 of query aligns to 10:402/420 of 6erkA
4cxqA Mycobaterium tuberculosis transaminase bioa complexed with substrate kapa (see paper)
35% identity, 94% coverage: 20:426/433 of query aligns to 10:418/427 of 4cxqA
- active site: Y18 (= Y28), Y149 (= Y155), E212 (= E212), D246 (= D246), A249 (≠ M249), K275 (= K275), Y399 (= Y407)
- binding 7-keto-8-aminopelargonic acid: W56 (= W63), Y149 (= Y155), G308 (= G309), T310 (≠ S311), R392 (= R400)
- binding pyridoxal-5'-phosphate: G116 (= G123), S117 (= S124), Y149 (= Y155), H150 (= H156), G151 (= G157), E212 (= E212), D246 (= D246), I248 (≠ V248), K275 (= K275), P309 (≠ H310), T310 (≠ S311)
4w1vA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with a thiazole inhibitor (see paper)
35% identity, 94% coverage: 20:426/433 of query aligns to 10:416/425 of 4w1vA
- active site: Y18 (= Y28), Y147 (= Y155), E210 (= E212), D244 (= D246), A247 (≠ M249), K273 (= K275), Y397 (= Y407)
- binding dimethyl (2R)-5-(3-fluorophenyl)-1H-pyrrolo[1,2-c][1,3]thiazole-6,7-dicarboxylate 2-oxide: P17 (= P27), Y18 (= Y28), W54 (= W63), M81 (≠ I90), G83 (≠ A92), Y147 (= Y155), G306 (= G309), P307 (≠ H310), T308 (≠ S311), F392 (≠ L402)
- binding pyridoxal-5'-phosphate: G114 (= G123), S115 (= S124), Y147 (= Y155), H148 (= H156), E210 (= E212), D244 (= D246), I246 (≠ V248), K273 (= K275)
4cxrA Mycobaterium tuberculosis transaminase bioa complexed with 1-(1,3- benzothiazol-2-yl)methanamine (see paper)
35% identity, 94% coverage: 20:426/433 of query aligns to 10:416/425 of 4cxrA
- active site: Y18 (= Y28), Y147 (= Y155), E210 (= E212), D244 (= D246), A247 (≠ M249), K273 (= K275), Y397 (= Y407)
- binding 1-(1,3-benzothiazol-2-yl)methanamine: Y18 (= Y28), W54 (= W63), W55 (= W64), A216 (≠ S218)
- binding pyridoxal-5'-phosphate: G114 (= G123), S115 (= S124), Y147 (= Y155), H148 (= H156), E210 (= E212), D244 (= D246), I246 (≠ V248), K273 (= K275), P307 (≠ H310), T308 (≠ S311)
3du4A Crystal structure of 7-keto-8-aminopelargonic acid bound 7,8- diaminopelargonic acid synthase in bacillus subtilis (see paper)
36% identity, 97% coverage: 15:433/433 of query aligns to 4:443/448 of 3du4A
- active site: F17 (≠ Y28), Y146 (= Y155), E217 (= E212), D251 (= D246), A254 (≠ M249), K280 (= K275), A417 (≠ Y407)
- binding 7-keto-8-aminopelargonic acid: L82 (≠ A92), Y146 (= Y155), G315 (= G309), S317 (= S311), R410 (= R400)
- binding pyridoxal-5'-phosphate: S112 (≠ N122), G113 (= G123), A114 (≠ S124), Y146 (= Y155), H147 (= H156), E217 (= E212), D251 (= D246), V253 (= V248), A254 (≠ M249), K280 (= K275), H316 (= H310), S317 (= S311)
P53555 L-Lysine--8-amino-7-oxononanoate transaminase; 7,8-diamino-pelargonic acid aminotransferase; DAPA AT; DAPA aminotransferase; 7,8-diaminononanoate synthase; DANS; Diaminopelargonic acid synthase; L-Lysine--8-amino-7-oxononanoate aminotransferase; EC 2.6.1.105 from Bacillus subtilis (strain 168) (see paper)
36% identity, 97% coverage: 15:433/433 of query aligns to 4:443/448 of P53555
- GA 113:114 (≠ GS 123:124) binding
- Y146 (= Y155) binding
- K280 (= K275) modified: N6-(pyridoxal phosphate)lysine
- G315 (= G309) binding
- HS 316:317 (= HS 310:311) binding
- R410 (= R400) binding
5te2A Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with a mechanism-based inhibitor (see paper)
35% identity, 94% coverage: 20:426/433 of query aligns to 10:419/428 of 5te2A
- active site: Y18 (= Y28), Y150 (= Y155), E213 (= E212), D247 (= D246), A250 (≠ M249), K276 (= K275), Y400 (= Y407)
- binding [5-hydroxy-4-({[6-(3-hydroxypropyl)-4-oxo-1,4-dihydropyridin-3-yl]amino}methyl)-6-methylpyridin-3-yl]methyl dihydrogen phosphate: Y18 (= Y28), W57 (= W63), G117 (= G123), S118 (= S124), Y150 (= Y155), H151 (= H156), G152 (= G157), D247 (= D246), I249 (≠ V248), K276 (= K275), G309 (= G309), P310 (≠ H310), T311 (≠ S311)
4xjoA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with an inhibitor optimized from hts lead (see paper)
35% identity, 94% coverage: 20:426/433 of query aligns to 10:419/428 of 4xjoA
- active site: Y18 (= Y28), Y150 (= Y155), E213 (= E212), D247 (= D246), A250 (≠ M249), K276 (= K275), Y400 (= Y407)
- binding 5-[4-(3-chlorobenzoyl)piperazin-1-yl]-1H-inden-1-one: P17 (= P27), Y18 (= Y28), W57 (= W63), M84 (≠ I90), G86 (≠ A92), Y150 (= Y155), G165 (vs. gap), G166 (vs. gap), A219 (≠ S218), P310 (≠ H310), T311 (≠ S311)
- binding pyridoxal-5'-phosphate: G117 (= G123), S118 (= S124), Y150 (= Y155), H151 (= H156), G152 (= G157), E213 (= E212), D247 (= D246), I249 (≠ V248), K276 (= K275), P310 (≠ H310), T311 (≠ S311)
4xewA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with a hts lead compound (see paper)
35% identity, 94% coverage: 20:426/433 of query aligns to 10:419/428 of 4xewA
- active site: Y18 (= Y28), Y150 (= Y155), E213 (= E212), D247 (= D246), A250 (≠ M249), K276 (= K275), Y400 (= Y407)
- binding 6-(2-fluorophenyl)[1,3]dioxolo[4,5-g]quinolin-8(5H)-one: P17 (= P27), Y18 (= Y28), W57 (= W63), Y150 (= Y155), P310 (≠ H310), T311 (≠ S311), R393 (= R400), F395 (≠ L402)
- binding pyridoxal-5'-phosphate: G117 (= G123), S118 (= S124), Y150 (= Y155), H151 (= H156), G152 (= G157), E213 (= E212), D247 (= D246), I249 (≠ V248), K276 (= K275), P310 (≠ H310), T311 (≠ S311)
4wyfA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with a dsf fragment hit (see paper)
35% identity, 94% coverage: 20:426/433 of query aligns to 10:419/428 of 4wyfA
- active site: Y18 (= Y28), Y150 (= Y155), E213 (= E212), D247 (= D246), A250 (≠ M249), K276 (= K275), Y400 (= Y407)
- binding N-(1-oxo-1H-inden-5-yl)acetamide: M84 (≠ I90), G86 (≠ A92), G309 (= G309), P310 (≠ H310), T311 (≠ S311)
- binding pyridoxal-5'-phosphate: G117 (= G123), S118 (= S124), Y150 (= Y155), H151 (= H156), G152 (= G157), E213 (= E212), D247 (= D246), I249 (≠ V248), K276 (= K275), P310 (≠ H310), T311 (≠ S311)
4wycA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with a thiazole benzamide inhibitor (see paper)
35% identity, 94% coverage: 20:426/433 of query aligns to 10:419/428 of 4wycA
- active site: Y18 (= Y28), Y150 (= Y155), E213 (= E212), D247 (= D246), A250 (≠ M249), K276 (= K275), Y400 (= Y407)
- binding 4-(1H-imidazol-1-yl)benzamide: P17 (= P27), Y18 (= Y28), W57 (= W63), M84 (≠ I90), G86 (≠ A92), Y150 (= Y155), G309 (= G309)
- binding pyridoxal-5'-phosphate: G117 (= G123), S118 (= S124), Y150 (= Y155), H151 (= H156), G152 (= G157), E213 (= E212), D247 (= D246), I249 (≠ V248), K276 (= K275), P310 (≠ H310), T311 (≠ S311)
4mqrA Mycobaterium tuberculosis transaminase bioa complexed with e)-5- hydroxy-4-(((z)-isonicotinoyldiazenyl)methylene)-6-methyl-1,4- dihydropyridin-3-yl)methyl phosphate (see paper)
35% identity, 94% coverage: 20:426/433 of query aligns to 10:419/428 of 4mqrA
- active site: Y18 (= Y28), Y150 (= Y155), E213 (= E212), D247 (= D246), A250 (≠ M249), K276 (= K275), Y400 (= Y407)
- binding [(4Z)-5-hydroxy-6-methyl-4-{[(E)-(pyridin-4-ylcarbonyl)diazenyl]methylidene}-1,4-dihydropyridin-3-yl]methyl dihydrogen phosphate: Y18 (= Y28), W57 (= W63), G117 (= G123), S118 (= S124), Y150 (= Y155), H151 (= H156), D247 (= D246), I249 (≠ V248), K276 (= K275), G309 (= G309), P310 (≠ H310), T311 (≠ S311)
4mqqA Mycobaterium tuberculosis transaminase bioa complexed with benzo[d]thiazole-2-carbohydrazide (see paper)
35% identity, 94% coverage: 20:426/433 of query aligns to 10:419/428 of 4mqqA
- active site: Y18 (= Y28), Y150 (= Y155), E213 (= E212), D247 (= D246), A250 (≠ M249), K276 (= K275), Y400 (= Y407)
- binding (4-{[(E)-(1,3-benzothiazol-2-ylcarbonyl)diazenyl]methyl}-5-hydroxy-6-methylpyridin-3-yl)methyl dihydrogen phosphate: Y18 (= Y28), W57 (= W63), W58 (= W64), G117 (= G123), S118 (= S124), Y150 (= Y155), H151 (= H156), D247 (= D246), I249 (≠ V248), K276 (= K275), P310 (≠ H310), T311 (≠ S311)
4mqpA Mycobaterium tuberculosis transaminase bioa complexed with 2- hydrazinylbenzo[d]thiazole (see paper)
35% identity, 94% coverage: 20:426/433 of query aligns to 10:419/428 of 4mqpA
- active site: Y18 (= Y28), Y150 (= Y155), E213 (= E212), D247 (= D246), A250 (≠ M249), K276 (= K275), Y400 (= Y407)
- binding (4-{[(E)-1,3-benzothiazol-2-yldiazenyl]methyl}-5-hydroxy-6-methylpyridin-3-yl)methyl dihydrogen phosphate: W57 (= W63), W58 (= W64), G117 (= G123), S118 (= S124), Y150 (= Y155), H151 (= H156), E213 (= E212), A219 (≠ S218), D247 (= D246), I249 (≠ V248), K276 (= K275), Y400 (= Y407)
P9WQ81 Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; 7,8-diamino-pelargonic acid aminotransferase; DAPA AT; DAPA aminotransferase; 7,8-diaminononanoate synthase; DANS; 7,8-diaminopelargonic acid synthase; DAPAS; Diaminopelargonic acid synthase; EC 2.6.1.62 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
35% identity, 94% coverage: 20:426/433 of query aligns to 17:426/437 of P9WQ81
- Y25 (= Y28) mutation to A: Does not show detectable activity at 335 nm with SAM, even up to concentrations of 3 mM, and shows approximately 70% reduced activity with high concentrations of DAPA (0.5 mM).
- W64 (= W63) binding
- Y157 (= Y155) binding
- K283 (= K275) modified: N6-(pyridoxal phosphate)lysine
- G316 (= G309) binding
5kgtA Crystal structure of 7,8-diaminopelargonic acid synthase (bioa) from mycobacterium tuberculosis, complexed with an inhibitor optimized from hts lead: 1-[4-[4-(3-chlorophenyl)carbonylpiperidin-1- yl]phenyl]ethanone (see paper)
35% identity, 94% coverage: 20:426/433 of query aligns to 10:419/429 of 5kgtA
- active site: Y18 (= Y28), Y150 (= Y155), E213 (= E212), D247 (= D246), A250 (≠ M249), K276 (= K275), Y400 (= Y407)
- binding 1-[4-[4-(3-chlorophenyl)carbonylpiperidin-1-yl]phenyl]ethanone: M84 (≠ I90), G86 (≠ A92), G309 (= G309), T311 (≠ S311)
- binding pyridoxal-5'-phosphate: S116 (≠ N122), G117 (= G123), S118 (= S124), Y150 (= Y155), H151 (= H156), G152 (= G157), E213 (= E212), D247 (= D246), I249 (≠ V248), K276 (= K275)
Query Sequence
>CA265_RS07530 FitnessBrowser__Pedo557:CA265_RS07530
MSDFSKPQTPDSKLNLTERDQKVIWHPYTQMKNALPHIPIVRGEGVYVFDESGKRYIDAV
SSWWVNIHGHSHPYIAQKVAEQLNVLEHVIFAGFTHEPAVLLAERLLPILPGKQDKVFYT
DNGSTAVEVALKMCLQYWDNKGTPKTKILAFKNAYHGDTFGAMSVSGRSIFTDAFNSLLF
DVEFIDLPNEYNISHLTSHLSNLSDTACFIFEPLILGSGGMLMYEAKYLDQLLSACKEAG
ILTIADEVMTGFGRTGTYFACEKLINKPDIICLSKGLTGGTMPLGVTTCTNEIFEAFLSD
DKLKTLYHGHSFTANPIACVASLASLDILLKSETLQNIKRVEAKHAVFLEEIKTHPKVKA
IRQTGTIIAIEWETGNETSYLSNLRNLLYAYFLDKGIILRPLGNIIYILPPYVISDEDLD
YIYATIKLALEEI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory