Comparing CA265_RS07705 FitnessBrowser__Pedo557:CA265_RS07705 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9NQR4 Omega-amidase NIT2; Nitrilase homolog 2; EC 3.5.1.3 from Homo sapiens (Human) (see 2 papers)
30% identity, 57% coverage: 217:502/502 of query aligns to 3:275/276 of Q9NQR4
6ypaB The c146a variant of an amidase from pyrococcus horikoshii with bound glutaramide
26% identity, 57% coverage: 213:496/502 of query aligns to 4:267/269 of 6ypaB
7ovgA The c146a variant of an amidase from pyrococcus horikoshii with bound acetamide (see paper)
26% identity, 56% coverage: 218:496/502 of query aligns to 3:261/263 of 7ovgA
Q9UYV8 Nitrilase; PaNit; EC 3.5.5.1 from Pyrococcus abyssi (strain GE5 / Orsay) (see paper)
27% identity, 52% coverage: 234:496/502 of query aligns to 17:260/262 of Q9UYV8
3klcB Crystal structure of hyperthermophilic nitrilase (see paper)
27% identity, 52% coverage: 234:496/502 of query aligns to 16:259/261 of 3klcB
Sites not aligning to the query:
3klcA Crystal structure of hyperthermophilic nitrilase (see paper)
27% identity, 52% coverage: 234:496/502 of query aligns to 16:259/261 of 3klcA
Sites not aligning to the query:
5h8jB Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with cadaverine (see paper)
28% identity, 47% coverage: 267:500/502 of query aligns to 64:288/297 of 5h8jB
Sites not aligning to the query:
5h8iC Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with n-(dihydroxymethyl)putrescine (see paper)
28% identity, 47% coverage: 267:500/502 of query aligns to 68:292/301 of 5h8iC
Sites not aligning to the query:
P47016 Deaminated glutathione amidase; dGSH amidase; Nitrilase homolog 1; EC 3.5.1.128 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
25% identity, 49% coverage: 251:496/502 of query aligns to 37:306/307 of P47016
4hg5A Structural insights into yeast nit2: wild-type yeast nit2 in complex with oxaloacetate (see paper)
25% identity, 49% coverage: 251:496/502 of query aligns to 34:303/304 of 4hg5A
4hg3A Structural insights into yeast nit2: wild-type yeast nit2 in complex with alpha-ketoglutarate (see paper)
25% identity, 49% coverage: 251:496/502 of query aligns to 34:303/304 of 4hg3A
4hgdA Structural insights into yeast nit2: c169s mutant of yeast nit2 in complex with an endogenous peptide-like ligand (see paper)
25% identity, 49% coverage: 251:496/502 of query aligns to 33:299/299 of 4hgdA
5h8lB Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) c158s mutant in complex with putrescine (see paper)
28% identity, 47% coverage: 267:500/502 of query aligns to 65:289/298 of 5h8lB
Sites not aligning to the query:
Q94JV5 Deaminated glutathione amidase, chloroplastic/cytosolic; dGSH amidase; Nitrilase-like protein 2; Protein nitrilase 1 homolog; AtNit1; Protein Nit1 homolog; EC 3.5.1.128 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 47% coverage: 246:480/502 of query aligns to 65:293/307 of Q94JV5
Sites not aligning to the query:
Q44185 N-carbamoyl-D-amino acid hydrolase; D-N-alpha-carbamilase; EC 3.5.1.77 from Rhizobium radiobacter (Agrobacterium tumefaciens) (Agrobacterium radiobacter) (see paper)
25% identity, 46% coverage: 253:482/502 of query aligns to 41:285/304 of Q44185
8hpcC Crystal structure of c171a mutant of n-carbamyl-d-amino acid amidohydrolase complexed with n-carbamyl-d-hydroxyphenylglycine
26% identity, 46% coverage: 252:482/502 of query aligns to 39:284/303 of 8hpcC
1uf8A Crystal structure of c171a/v236a mutant of n-carbamyl-d-amino acid amidohydrolase complexed with n-carbamyl-d-phenylalanine
25% identity, 46% coverage: 252:482/502 of query aligns to 39:284/303 of 1uf8A
1uf7A Crystal structure of c171a/v236a mutant of n-carbamyl-d-amino acid amidohydrolase complexed with n-carbamyl-d-valine
25% identity, 46% coverage: 252:482/502 of query aligns to 39:284/303 of 1uf7A
1uf5A Crystal structure of c171a/v236a mutant of n-carbamyl-d-amino acid amidohydrolase complexed with n-carbamyl-d-methionine
25% identity, 46% coverage: 252:482/502 of query aligns to 39:284/303 of 1uf5A
7uciA Sxta methyltransferase and decarboxylase didomain in complex with mn2+ and sah (see paper)
21% identity, 34% coverage: 32:201/502 of query aligns to 512:683/686 of 7uciA
Sites not aligning to the query:
>CA265_RS07705 FitnessBrowser__Pedo557:CA265_RS07705
MNIELRKLTLEDYADLKESMLQAYDSMGGSIWPKSSIAKLLNIFPEGQLCIAVDDKVVAC
SLAIIVEYDEYGDRHTYKLITGDYSFTTHDPNGDTLYGIEIFVHPDYRGLRLGRRLYEAR
KELCESLNLKSIIAGGRIPGYHQYAEQLSPRQYIDKVKAKEIYDPTLTFQISNDFHVRKV
LKNYLPGDKESKEYATLIEWNNIYYQGIDASARSAMTIRLGLVQWEMRLFPNMDAFYEQV
EFFVDALSGYKSDFVMFPELFNTPLLQPYNHLPEIEAMRKLAEKTEEIVQKMHEYSLSYN
TNIITGSMPLIEDGKLYNATYLCHRTGKIDEYRKIHITPNEQKYYGMIGGDKVQVFDTDC
GKVGILICYDVEFPELSRIYADQGMQILFVPFLTDTQNGYTRVRHCAQARAIENECYVAI
AGCVGNLPKVNNMDIQFAQSAVFTPSDFAFPTNAIKAEATPNTEMVLVVDVDLHLLDELH
HYGTVKVLKDRRKDLYQVKLLK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory