Comparing CA265_RS07875 FitnessBrowser__Pedo557:CA265_RS07875 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
Q9SS48 Glycerol-3-phosphate dehydrogenase SDP6, mitochondrial; Protein SUGAR-DEPENDENT 6; EC 1.1.5.3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
40% identity, 93% coverage: 16:506/530 of query aligns to 75:606/629 of Q9SS48
2rgoB Structure of alpha-glycerophosphate oxidase from streptococcus sp.: A template for the mitochondrial alpha-glycerophosphate dehydrogenase (see paper)
32% identity, 89% coverage: 37:508/530 of query aligns to 39:517/530 of 2rgoB
Sites not aligning to the query:
2rgoA Structure of alpha-glycerophosphate oxidase from streptococcus sp.: A template for the mitochondrial alpha-glycerophosphate dehydrogenase (see paper)
35% identity, 70% coverage: 37:406/530 of query aligns to 41:423/557 of 2rgoA
Sites not aligning to the query:
3da1A X-ray structure of the glycerol-3-phosphate dehydrogenase from bacillus halodurans complexed with fad. Northeast structural genomics consortium target bhr167.
30% identity, 91% coverage: 31:512/530 of query aligns to 35:488/496 of 3da1A
Sites not aligning to the query:
2qcuB Crystal structure of glycerol-3-phosphate dehydrogenase from escherichia coli (see paper)
27% identity, 86% coverage: 38:495/530 of query aligns to 27:498/501 of 2qcuB
Sites not aligning to the query:
2r46A Crystal structure of escherichia coli glycerol-3-phosphate dehydrogenase in complex with 2-phosphopyruvic acid. (see paper)
27% identity, 85% coverage: 40:492/530 of query aligns to 29:491/495 of 2r46A
Sites not aligning to the query:
2r45A Crystal structure of escherichia coli glycerol-3-phosphate dehydrogenase in complex with 2-phospho-d-glyceric acid (see paper)
27% identity, 85% coverage: 40:492/530 of query aligns to 29:491/495 of 2r45A
Sites not aligning to the query:
Q9HUH4 Probable FAD-dependent oxidoreductase PA4991; EC 1.-.-.- from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
24% identity, 36% coverage: 9:200/530 of query aligns to 1:189/391 of Q9HUH4
Sites not aligning to the query:
>CA265_RS07875 FitnessBrowser__Pedo557:CA265_RS07875
MKRLHPHHIAENINWDFIIIGGGATGLGTALDAASRGFKTLLVEQSDFAKGTSSRSTKLV
HGGVRYLAQGDIGLVKHALKERGLLQQNAKHLVNKEEFLIPCYDWFSVVKYLTGLTLYDW
LAGKYSFGKSKFFSKKETLTMMPGIKEKGLKGSIRYYDGKFDDARLAINIAQTAIENGAS
LLNYTKVTGLLKSGDQVTGIETEDTITGLTAKYNGKIVINATGVFVDDILQMNNPNSKKM
VRPSQGVHVVLDKSFLNSESALMIPKTSDGRVLFAVPWHDHLLVGTTDTPLDEHSLEPRA
LKKEVDFIMSTAASYFNRKPLEKDILSVFSGLRPLAAPTNGDGNSTKEISRDHKLIVSAK
GLITITGGKWTTYRRMAEETVDLAITHGGLESKACVTQNLSIHGSSTTTGDHHLAIYGTD
RSKIEALIVQDPGLGNKLNPAFPFTEAEVIWSARNEMAETVEDILSRRLRILFINAQAAK
DMAPRVASLLAQELSADKNWETNQIETFNKLADGYIYHSTPKITESALAN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory