Comparing CA265_RS08135 FitnessBrowser__Pedo557:CA265_RS08135 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 17 hits to proteins with known functional sites (download)
Q9NQR4 Omega-amidase NIT2; Nitrilase homolog 2; EC 3.5.1.3 from Homo sapiens (Human) (see 2 papers)
26% identity, 82% coverage: 39:251/259 of query aligns to 38:262/276 of Q9NQR4
Q94JV5 Deaminated glutathione amidase, chloroplastic/cytosolic; dGSH amidase; Nitrilase-like protein 2; Protein nitrilase 1 homolog; AtNit1; Protein Nit1 homolog; EC 3.5.1.128 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
27% identity, 85% coverage: 39:258/259 of query aligns to 71:305/307 of Q94JV5
Sites not aligning to the query:
P47016 Deaminated glutathione amidase; dGSH amidase; Nitrilase homolog 1; EC 3.5.1.128 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
26% identity, 90% coverage: 17:249/259 of query aligns to 18:297/307 of P47016
4hg5A Structural insights into yeast nit2: wild-type yeast nit2 in complex with oxaloacetate (see paper)
26% identity, 90% coverage: 17:249/259 of query aligns to 15:294/304 of 4hg5A
4hg3A Structural insights into yeast nit2: wild-type yeast nit2 in complex with alpha-ketoglutarate (see paper)
26% identity, 90% coverage: 17:249/259 of query aligns to 15:294/304 of 4hg3A
Q9UYV8 Nitrilase; PaNit; EC 3.5.5.1 from Pyrococcus abyssi (strain GE5 / Orsay) (see paper)
24% identity, 76% coverage: 34:229/259 of query aligns to 32:228/262 of Q9UYV8
3klcB Crystal structure of hyperthermophilic nitrilase (see paper)
24% identity, 76% coverage: 34:229/259 of query aligns to 31:227/261 of 3klcB
Sites not aligning to the query:
3klcA Crystal structure of hyperthermophilic nitrilase (see paper)
24% identity, 76% coverage: 34:229/259 of query aligns to 31:227/261 of 3klcA
Sites not aligning to the query:
6ypaB The c146a variant of an amidase from pyrococcus horikoshii with bound glutaramide
26% identity, 76% coverage: 34:229/259 of query aligns to 39:235/269 of 6ypaB
7ovgA The c146a variant of an amidase from pyrococcus horikoshii with bound acetamide (see paper)
26% identity, 76% coverage: 34:229/259 of query aligns to 33:229/263 of 7ovgA
4hgdA Structural insights into yeast nit2: c169s mutant of yeast nit2 in complex with an endogenous peptide-like ligand (see paper)
26% identity, 90% coverage: 17:249/259 of query aligns to 14:290/299 of 4hgdA
5h8iC Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with n-(dihydroxymethyl)putrescine (see paper)
28% identity, 68% coverage: 65:241/259 of query aligns to 75:260/301 of 5h8iC
Sites not aligning to the query:
5h8jB Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with cadaverine (see paper)
28% identity, 68% coverage: 65:241/259 of query aligns to 71:256/297 of 5h8jB
Sites not aligning to the query:
5h8lB Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) c158s mutant in complex with putrescine (see paper)
28% identity, 68% coverage: 65:241/259 of query aligns to 72:257/298 of 5h8lB
Sites not aligning to the query:
5khaA Structure of glutamine-dependent NAD+ synthetase from acinetobacter baumannii in complex with adenosine diphosphate (adp)
22% identity, 97% coverage: 2:251/259 of query aligns to 1:257/526 of 5khaA
Sites not aligning to the query:
4izuA The e41q mutant of the amidase from nesterenkonia sp. An1 showing the result of michael addition of acrylamide at the active site cysteine
28% identity, 44% coverage: 108:221/259 of query aligns to 110:223/254 of 4izuA
Sites not aligning to the query:
4iztA The e41q mutant of the amidase from nesterenkonia sp. An1 showing covalent addition of the acetamide moiety of fluoroacetamide at the active site cysteine
28% identity, 44% coverage: 108:221/259 of query aligns to 118:231/263 of 4iztA
>CA265_RS08135 FitnessBrowser__Pedo557:CA265_RS08135
MENLKVTVFQAYLFWENIEKNLLNLALRLSMGVREKTDIIVLPEMFNTGFSMNSEALAEE
MGGKTMQWMQKMAHQYNCVVTGSIIIKENNQYFNRLIWMEPDGKNQHYDKRHLFGMGDED
EHFSPGKEKLIVELKGWKIRLAICYDLRFPVWLRNVDQEYDILLLVANWPDKRSAHWKAL
IPARAIENQSYVIAVNRVGHDGNQIYHSGLSMCLDPYGNTVYYKPEDEDLYTFSINYEEL
VKVRRQFPFLKDADRFTIS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory