Comparing CA265_RS08190 FitnessBrowser__Pedo557:CA265_RS08190 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5x5hA Crystal structure of metb from corynebacterium glutamicum (see paper)
45% identity, 99% coverage: 5:370/371 of query aligns to 10:381/385 of 5x5hA
4iyoB Crystal structure of cystathionine gamma lyase from xanthomonas oryzae pv. Oryzae (xometc) in complex with e-site serine, a-site serine, a- site external aldimine structure with aminoacrylate and a-site iminopropionate intermediates (see paper)
44% identity, 99% coverage: 5:370/371 of query aligns to 6:380/381 of 4iyoB
4iy7B Crystal structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae in complex with e-site serine, a-site external aldimine structure with serine and a-site external aldimine structure with aminoacrylate intermediates (see paper)
44% identity, 99% coverage: 5:370/371 of query aligns to 6:380/381 of 4iy7B
4iy7A Crystal structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae in complex with e-site serine, a-site external aldimine structure with serine and a-site external aldimine structure with aminoacrylate intermediates (see paper)
44% identity, 99% coverage: 5:370/371 of query aligns to 6:380/381 of 4iy7A
4ixzA Native structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae at ph 9.0 (see paper)
44% identity, 99% coverage: 5:370/371 of query aligns to 6:380/381 of 4ixzA
4iyoD Crystal structure of cystathionine gamma lyase from xanthomonas oryzae pv. Oryzae (xometc) in complex with e-site serine, a-site serine, a- site external aldimine structure with aminoacrylate and a-site iminopropionate intermediates (see paper)
44% identity, 99% coverage: 5:370/371 of query aligns to 6:380/384 of 4iyoD
3qhxA Crystal structure of cystathionine gamma-synthase metb (cgs) from mycobacterium ulcerans agy99 bound to hepes (see paper)
44% identity, 99% coverage: 5:371/371 of query aligns to 5:377/377 of 3qhxA
4ixsB Native structure of xometc at ph 5.2 (see paper)
43% identity, 99% coverage: 5:370/371 of query aligns to 5:371/372 of 4ixsB
7ba4A Structure of cystathionine gamma-lyase from pseudomonas aeruginosa
42% identity, 99% coverage: 5:370/371 of query aligns to 9:371/377 of 7ba4A
6k1lB E53a mutant of a putative cystathionine gamma-lyase (see paper)
44% identity, 99% coverage: 5:370/371 of query aligns to 7:381/382 of 6k1lB
6k1lA E53a mutant of a putative cystathionine gamma-lyase (see paper)
44% identity, 99% coverage: 5:370/371 of query aligns to 7:381/382 of 6k1lA
6cjaA Crystal structure of cystathionine beta-lyase from legionella pneumophila philadelphia 1 in complex with alanyl-plp and serine
44% identity, 99% coverage: 4:371/371 of query aligns to 5:381/381 of 6cjaA
7d7oB Crystal structure of cystathionine gamma-lyase from bacillus cereus atcc 14579 (see paper)
43% identity, 100% coverage: 1:370/371 of query aligns to 1:376/377 of 7d7oB
8j6nA Crystal structure of cystathionine gamma-lyase in complex with compound 1 (see paper)
44% identity, 94% coverage: 21:370/371 of query aligns to 28:385/390 of 8j6nA
4l0oH Structure determination of cystathionine gamma-synthase from helicobacter pylori
42% identity, 100% coverage: 1:370/371 of query aligns to 1:370/373 of 4l0oH
1n8pA Crystal structure of cystathionine gamma-lyase from yeast (see paper)
43% identity, 99% coverage: 5:370/371 of query aligns to 10:388/393 of 1n8pA
5dx5A Crystal structure of methionine gamma-lyase from clostridium sporogenes (see paper)
40% identity, 99% coverage: 5:370/371 of query aligns to 10:394/399 of 5dx5A
7mcyH Crystal structure of staphylococcus aureus cystathionine gamma lyase, holoenzyme with bound nl3 (see paper)
41% identity, 99% coverage: 4:370/371 of query aligns to 4:377/380 of 7mcyH
Sites not aligning to the query:
7mcuH Crystal structure of staphylococcus aureus cystathionine gamma lyase, holoenzyme with bound nl2 (see paper)
41% identity, 99% coverage: 4:370/371 of query aligns to 4:377/380 of 7mcuH
Sites not aligning to the query:
7mctH Crystal structure of staphylococcus aureus cystathionine gamma lyase, holoenzyme with bound nl1 (see paper)
41% identity, 99% coverage: 4:370/371 of query aligns to 4:377/380 of 7mctH
Sites not aligning to the query:
>CA265_RS08190 FitnessBrowser__Pedo557:CA265_RS08190
MKPETLAIHASNLVKSITGDVTPPLNLSTTFFRDAEGGYPGGHMYSRVSNPNRSALENTV
AKLEYGEDAAAFSSGNTCGLVLFQALKPGSHIIAPDDMYWGIKKQLLTIFNDSLEFDFID
QTDLDLIQASIRSNTKLIWIETPSNPLLKVTDIEEIAKIAKAKNITLACDSTFASPILQN
PILLGADIVMHSSTKYLGGHSDVLGGILVTAKKDELWEKIKNIQQTGGAVPSPFDCFLLT
RSIKTLAYRMKGHCENGKIIADYLNAHPNVEAVFYPGLESHPQHDIAKKQMKDFGGMMSF
LVKGDVEAAHKVVNKVQLFAQATSLGGVESLIEHRYSVEGPDSKTPKNLLRISVGLEHAD
DIIADLAQALG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory