SitesBLAST
Comparing CA265_RS08325 CA265_RS08325 haloacid dehalogenase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6w04A Crystal structure of had hydrolase, family ia, variant 3 from entamoeba histolytica hm-1:imss
27% identity, 87% coverage: 9:201/223 of query aligns to 2:196/223 of 6w04A
- active site: D7 (= D14), F8 (≠ L15), N9 (= N16), D15 (= D22), N44 (≠ M51), T109 (≠ S116), S110 (≠ A117), K144 (= K149), E168 (= E173), D169 (= D174)
- binding magnesium ion: D7 (= D14), N9 (= N16), D169 (= D174)
5o6pA Structure of beta-phosphoglucomutase d10n mutant in complex with glucose-1,6-bisphosphate
29% identity, 87% coverage: 9:201/223 of query aligns to 2:203/209 of 5o6pA
- active site: D7 (= D14), L8 (= L15), N9 (= N16), T15 (≠ D22), K44 (≠ Y52), S113 (= S116), A114 (= A117), K144 (= K149), E168 (= E173), D169 (= D174)
- binding 1,6-di-O-phosphono-beta-D-glucopyranose: D7 (= D14), L8 (= L15), N9 (= N16), H19 (= H26), L43 (≠ M51), K44 (≠ Y52), G45 (= G53), V46 (≠ K54), R48 (≠ H56), S113 (= S116), A114 (= A117), S115 (≠ A118), K116 (≠ I119), K144 (= K149)
- binding magnesium ion: D7 (= D14), N9 (= N16), D169 (= D174)
5ok0A Structure of the d10n mutant of beta-phosphoglucomutase from lactococcus lactis trapped with native reaction intermediate beta- glucose 1,6-bisphosphate to 2.2a resolution.
30% identity, 82% coverage: 9:191/223 of query aligns to 3:188/218 of 5ok0A
- active site: D8 (= D14), L9 (= L15), N10 (= N16), T16 (≠ D22), K45 (≠ Y52), S114 (= S116), A115 (= A117), K145 (= K149), E169 (= E173), D170 (= D174)
- binding 1,6-di-O-phosphono-beta-D-glucopyranose: D8 (= D14), L9 (= L15), N10 (= N16), H20 (= H26), L44 (≠ M51), V47 (≠ K54), R49 (≠ H56), S114 (= S116), A115 (= A117), S116 (≠ A118)
- binding magnesium ion: D8 (= D14), N10 (= N16), D170 (= D174)
- binding 1,3-propandiol: I33 (≠ A40), N34 (≠ K41), G35 (≠ L42), V36 (≠ D43)
5o6rA Structure of beta-phosphoglucomutase d10n mutant in complex with glucose-1-phosphate and aluminium tetrafluoride
30% identity, 82% coverage: 9:191/223 of query aligns to 3:188/218 of 5o6rA
- active site: D8 (= D14), L9 (= L15), N10 (= N16), T16 (≠ D22), K45 (≠ Y52), S114 (= S116), A115 (= A117), K145 (= K149), E169 (= E173), D170 (= D174)
- binding tetrafluoroaluminate ion: D8 (= D14), L9 (= L15), N10 (= N16), G46 (= G53), S114 (= S116), K145 (= K149)
- binding magnesium ion: D8 (= D14), N10 (= N16), D170 (= D174)
- binding 1-O-phosphono-beta-D-glucopyranose: H20 (= H26), W24 (= W30), L44 (≠ M51), V47 (≠ K54), R49 (≠ H56), S52 (≠ V58), S116 (≠ A118), K117 (≠ I119), N118 (= N122)
P71447 Beta-phosphoglucomutase; Beta-PGM; EC 5.4.2.6 from Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis) (see 3 papers)
29% identity, 82% coverage: 9:191/223 of query aligns to 3:188/221 of P71447
- D8 (= D14) modified: 4-aspartylphosphate; mutation to A: Inactive.; mutation to E: Inactive.
- D10 (≠ N16) mutation to A: Inactive.; mutation to E: Inactive.; mutation to N: Inactive.; mutation to S: Inactive.
- T16 (≠ D22) mutation to P: 500-fold reduction in the rate constant for Asp-8 phosphorylation by beta-G1,6bisP. 6,700-fold reduction in the apparent rate constant for cycling of the phosphorylated enzyme to convert beta-G1P to G6P. 13-fold increase in the estimated rate constant for phosphoryl transfer from the phospho-Asp8 to water.
- H20 (= H26) mutation to A: Impairs Asp-8 phosphorylation by beta-G1,6bisP and phosphoryl transfer from the phospho-Asp8 to the substrate beta-G1P.; mutation to N: 300-fold reduction in the conversion of beta-G1P to G6P in the presence of beta-G1,6bisP.; mutation to Q: 8-fold reduction in the conversion of beta-G1P to G6P in the presence of beta-G1,6bisP.
- K45 (≠ Y52) mutation to A: 20'000-fold decrease in kcat/KM.
- G46 (= G53) mutation to A: 1'000'000-fold decrease in kcat/KM.; mutation to P: 100'000-fold decrease in kcat/KM.; mutation to V: 10'000-fold decrease in kcat/KM.
- R49 (≠ H56) mutation to K: 1'000'000-fold decrease in kcat/KM.
- S52 (≠ V58) mutation to A: Wild-type activity.
- K76 (≠ Y84) mutation to A: 100-fold reduction in the conversion of beta-G1P to G6P in the presence of beta-G1,6bisP.
- D170 (= D174) mutation to A: Impaired, but active with an increase in the affinity for G1P.
5olwA 5-fluorotryptophan labeled beta-phosphoglucomutase in an open conformation (see paper)
29% identity, 82% coverage: 9:191/223 of query aligns to 3:188/224 of 5olwA
- active site: D8 (= D14), L9 (= L15), D10 (≠ N16), T16 (≠ D22), K45 (≠ Y52), S114 (= S116), A115 (= A117), K145 (= K149), E169 (= E173), D170 (= D174)
- binding calcium ion: D8 (= D14), D10 (≠ N16), P89 (≠ G97), V92 (= V100), E124 (≠ D128), N127 (= N131), E169 (= E173), D170 (= D174), S171 (≠ A175)
2wf9A Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate, and beryllium trifluoride, crystal form 2 (see paper)
29% identity, 82% coverage: 9:191/223 of query aligns to 3:188/221 of 2wf9A
- active site: D8 (= D14), L9 (= L15), D10 (≠ N16), T16 (≠ D22), K45 (≠ Y52), S114 (= S116), A115 (= A117), K145 (= K149), E169 (= E173), D170 (= D174)
- binding beryllium trifluoride ion: D8 (= D14), L9 (= L15), D10 (≠ N16), S114 (= S116), A115 (= A117), K145 (= K149)
- binding 6-O-phosphono-beta-D-glucopyranose: D10 (≠ N16), H20 (= H26), G46 (= G53), V47 (≠ K54), R49 (≠ H56), S116 (≠ A118), K117 (≠ I119), N118 (= N122)
- binding 6-O-phosphono-alpha-D-glucopyranose: D10 (≠ N16), H20 (= H26), G46 (= G53), V47 (≠ K54), R49 (≠ H56), A115 (= A117), S116 (≠ A118), K117 (≠ I119), N118 (= N122)
- binding magnesium ion: D8 (= D14), D10 (≠ N16), D170 (= D174)
1o03A Structure of pentavalent phosphorous intermediate of an enzyme catalyzed phosphoryl transfer reaction observed on cocrystallization with glucose 6-phosphate (see paper)
29% identity, 82% coverage: 9:191/223 of query aligns to 3:188/221 of 1o03A
- active site: D8 (= D14), L9 (= L15), D10 (≠ N16), T16 (≠ D22), K45 (≠ Y52), S114 (= S116), A115 (= A117), K145 (= K149), E169 (= E173), D170 (= D174)
- binding 1,6-di-O-phosphono-alpha-D-glucopyranose: D8 (= D14), L9 (= L15), D10 (≠ N16), H20 (= H26), G46 (= G53), V47 (≠ K54), R49 (≠ H56), S114 (= S116), A115 (= A117), S116 (≠ A118), K117 (≠ I119), K145 (= K149)
- binding magnesium ion: D8 (= D14), D10 (≠ N16), D170 (= D174)
1lvhA The structure of phosphorylated beta-phosphoglucomutase from lactoccocus lactis to 2.3 angstrom resolution (see paper)
29% identity, 82% coverage: 9:191/223 of query aligns to 3:188/221 of 1lvhA
- active site: D8 (= D14), L9 (= L15), D10 (≠ N16), T16 (≠ D22), K45 (≠ Y52), S114 (= S116), A115 (= A117), K145 (= K149), E169 (= E173), D170 (= D174)
- binding magnesium ion: D8 (= D14), D10 (≠ N16), D170 (= D174)
6h91A Phosphorylated beta-phosphoglucomutase from lactococcus lactis in an open conformer to 2.4 a
29% identity, 82% coverage: 9:191/223 of query aligns to 3:188/218 of 6h91A
4c4rA Structure of beta-phosphoglucomutase in complex with a phosphonate analogue of beta-glucose-1-phosphate and magnesium trifluoride (see paper)
29% identity, 82% coverage: 9:191/223 of query aligns to 3:188/218 of 4c4rA
- active site: D8 (= D14), L9 (= L15), D10 (≠ N16), T16 (≠ D22), K45 (≠ Y52), S114 (= S116), A115 (= A117), K145 (= K149), E169 (= E173), D170 (= D174)
- binding magnesium ion: D8 (= D14), D10 (≠ N16), D170 (= D174)
- binding trifluoromagnesate: D8 (= D14), L9 (= L15), D10 (≠ N16), S114 (= S116), A115 (= A117), K145 (= K149)
- binding (1R)-1,5-anhydro-1-(phosphonomethyl)-D-glucitol: D10 (≠ N16), H20 (= H26), W24 (= W30), L44 (≠ M51), G46 (= G53), V47 (≠ K54), R49 (≠ H56), S52 (≠ V58), S116 (≠ A118), K117 (≠ I119)
3zi4A The structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate and scandium tetrafluoride
29% identity, 82% coverage: 9:191/223 of query aligns to 3:188/218 of 3zi4A
- active site: D8 (= D14), L9 (= L15), D10 (≠ N16), T16 (≠ D22), K45 (≠ Y52), S114 (= S116), A115 (= A117), K145 (= K149), E169 (= E173), D170 (= D174)
- binding 6-O-phosphono-beta-D-glucopyranose: D10 (≠ N16), H20 (= H26), G46 (= G53), V47 (≠ K54), R49 (≠ H56), S116 (≠ A118), K117 (≠ I119)
- binding magnesium ion: D8 (= D14), D10 (≠ N16), D170 (= D174)
- binding Scandium Tetrafluoride: D8 (= D14), L9 (= L15), D10 (≠ N16), S114 (= S116), A115 (= A117), K145 (= K149)
2wf8A Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate, glucose-1-phosphate and beryllium trifluoride (see paper)
29% identity, 82% coverage: 9:191/223 of query aligns to 3:188/218 of 2wf8A
- active site: D8 (= D14), L9 (= L15), D10 (≠ N16), T16 (≠ D22), K45 (≠ Y52), S114 (= S116), A115 (= A117), K145 (= K149), E169 (= E173), D170 (= D174)
- binding beryllium trifluoride ion: D8 (= D14), L9 (= L15), D10 (≠ N16), S114 (= S116), A115 (= A117), K145 (= K149)
- binding 6-O-phosphono-beta-D-glucopyranose: D10 (≠ N16), H20 (= H26), G46 (= G53), V47 (≠ K54), R49 (≠ H56), A115 (= A117), S116 (≠ A118), K117 (≠ I119)
- binding 1-O-phosphono-alpha-D-glucopyranose: D10 (≠ N16), H20 (= H26), W24 (= W30), L44 (≠ M51), G46 (= G53), V47 (≠ K54), R49 (≠ H56), S52 (≠ V58), A115 (= A117), S116 (≠ A118), K117 (≠ I119)
- binding magnesium ion: D8 (= D14), D10 (≠ N16), D170 (= D174)
2wf7A Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphonate and aluminium tetrafluoride (see paper)
29% identity, 82% coverage: 9:191/223 of query aligns to 3:188/218 of 2wf7A
- active site: D8 (= D14), L9 (= L15), D10 (≠ N16), T16 (≠ D22), K45 (≠ Y52), S114 (= S116), A115 (= A117), K145 (= K149), E169 (= E173), D170 (= D174)
- binding tetrafluoroaluminate ion: D8 (= D14), L9 (= L15), D10 (≠ N16), S114 (= S116), K145 (= K149)
- binding 6,7-dideoxy-7-phosphono-beta-D-gluco-heptopyranose: D10 (≠ N16), G46 (= G53), V47 (≠ K54), R49 (≠ H56), S116 (≠ A118), K117 (≠ I119), N118 (= N122)
- binding magnesium ion: D8 (= D14), D10 (≠ N16), D170 (= D174)
2wf6A Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate and aluminium tetrafluoride (see paper)
29% identity, 82% coverage: 9:191/223 of query aligns to 3:188/218 of 2wf6A
- active site: D8 (= D14), L9 (= L15), D10 (≠ N16), T16 (≠ D22), K45 (≠ Y52), S114 (= S116), A115 (= A117), K145 (= K149), E169 (= E173), D170 (= D174)
- binding tetrafluoroaluminate ion: D8 (= D14), L9 (= L15), D10 (≠ N16), S114 (= S116), K145 (= K149)
- binding 6-O-phosphono-beta-D-glucopyranose: D10 (≠ N16), G46 (= G53), V47 (≠ K54), R49 (≠ H56), S116 (≠ A118), K117 (≠ I119)
- binding magnesium ion: D8 (= D14), D10 (≠ N16), D170 (= D174)
2wf5A Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate and trifluoromagnesate (see paper)
29% identity, 82% coverage: 9:191/223 of query aligns to 3:188/218 of 2wf5A
- active site: D8 (= D14), L9 (= L15), D10 (≠ N16), T16 (≠ D22), K45 (≠ Y52), S114 (= S116), A115 (= A117), K145 (= K149), E169 (= E173), D170 (= D174)
- binding 6-O-phosphono-beta-D-glucopyranose: D10 (≠ N16), H20 (= H26), G46 (= G53), V47 (≠ K54), R49 (≠ H56), A115 (= A117), S116 (≠ A118)
- binding magnesium ion: D8 (= D14), D10 (≠ N16), D170 (= D174)
- binding trifluoromagnesate: D8 (= D14), L9 (= L15), D10 (≠ N16), S114 (= S116), A115 (= A117), K145 (= K149)
6qzgA Beta-glucose 1,6-bisphosphonate bound to wild type beta- phosphoglucomutse in an open conformation.
29% identity, 82% coverage: 9:191/223 of query aligns to 3:188/219 of 6qzgA
- binding 3,7-anhydro-1,2,8-trideoxy-1,8-diphosphono-D-glycero-D-gulo-octitol: D8 (= D14), L9 (= L15), D10 (≠ N16), H20 (= H26), G46 (= G53), S114 (= S116), A115 (= A117), S116 (≠ A118), K117 (≠ F121), K145 (= K149)
- binding magnesium ion: D8 (= D14), D10 (≠ N16), D170 (= D174)
1z4nA Structure of beta-phosphoglucomutase with inhibitor bound alpha- galactose 1-phosphate cocrystallized with fluoride (see paper)
29% identity, 82% coverage: 9:191/223 of query aligns to 3:188/219 of 1z4nA
- active site: D8 (= D14), L9 (= L15), D10 (≠ N16), T16 (≠ D22), K45 (≠ Y52), S114 (= S116), A115 (= A117), K145 (= K149), E169 (= E173), D170 (= D174)
- binding 1-O-phosphono-alpha-D-galactopyranose: H20 (= H26), W24 (= W30), V47 (≠ K54), R49 (≠ H56), S116 (≠ A118), K117 (≠ F121), N118 (= N122)
- binding magnesium ion: D8 (= D14), D10 (≠ N16), E169 (= E173), D170 (= D174)
4g9bA Crystal structure of beta-phosphoglucomutase homolog from escherichia coli, target efi-501172, with bound mg, open lid
29% identity, 82% coverage: 6:187/223 of query aligns to 2:186/227 of 4g9bA
- active site: D10 (= D14), L11 (= L15), D12 (≠ N16), T18 (≠ D22), K46 (≠ M51), S117 (≠ A118), V118 (≠ I119), K148 (= K149), E172 (= E173), D173 (= D174)
- binding magnesium ion: D10 (= D14), D12 (≠ N16), D173 (= D174)
4c4sA Structure of beta-phosphoglucomutase in complex with an alpha- fluorophosphonate analogue of beta-glucose-1-phosphate and magnesium trifluoride (see paper)
29% identity, 82% coverage: 9:191/223 of query aligns to 3:185/215 of 4c4sA
- active site: D8 (= D14), L9 (= L15), D10 (≠ N16), T16 (≠ D22), K45 (≠ Y52), S111 (= S116), A112 (= A117), K142 (= K149), E166 (= E173), D167 (= D174)
- binding (1R)-1,5-anhydro-1-[(S)-fluoro(phosphono)methyl]-D-glucitol: D10 (≠ N16), H20 (= H26), W24 (= W30), L44 (≠ M51), G46 (= G53), V47 (≠ K54), R49 (≠ H56), S113 (≠ A118)
- binding magnesium ion: D8 (= D14), D10 (≠ N16), D167 (= D174)
- binding trifluoromagnesate: D8 (= D14), L9 (= L15), D10 (≠ N16), S111 (= S116), A112 (= A117), K142 (= K149)
Query Sequence
>CA265_RS08325 CA265_RS08325 haloacid dehalogenase
MHNLNFKPKAFLFDLNGTMINDMEYHTLAWYSIMTEDLGAKLDYESVKKEMYGKNHEVLE
RVFGKDKFNAEEIERLSIDKEKRYQEGYLPHLALIEGLDVFLERTKQAHIPMAIGSAAIP
FNIDFVIDGLNIRHYLDAIVSADDVKTSKPDPETFLKAAAALNIAPANCLVFEDAPKGVE
SALNAGMPCMVLNTTHTIEEFEGYPNILGYITDYNDAKLNRLF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory