SitesBLAST
Comparing CA265_RS08335 FitnessBrowser__Pedo557:CA265_RS08335 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P20932 (S)-mandelate dehydrogenase; MDH; L(+)-mandelate dehydrogenase; EC 1.1.99.31 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 3 papers)
34% identity, 96% coverage: 15:388/389 of query aligns to 7:374/393 of P20932
- PTG 79:81 (≠ PIG 87:89) binding
- G81 (= G89) mutation to A: 23-fold decrease in catalytic activity with mandelate as substrate and DCPIP as electron acceptor, but no change in affinity for mandelate. Shows a modestly higher reactivity with molecular oxygen.
- S108 (= S116) binding
- Q129 (= Q137) binding
- T156 (≠ L165) binding
- K250 (= K261) binding
- DSGFR 303:307 (≠ DGGIR 318:322) binding
- GR 326:327 (= GR 341:342) binding
6bfgA Crystal structure of monotopic membrane protein (s)-mandelate dehydrogenase (see paper)
34% identity, 96% coverage: 15:388/389 of query aligns to 5:372/373 of 6bfgA
- active site: Y129 (= Y139), D156 (= D167), H272 (= H285)
- binding flavin mononucleotide: Y24 (= Y34), P77 (= P87), T78 (≠ I88), G79 (= G89), Q127 (= Q137), Y129 (= Y139), T154 (≠ L165), K248 (= K261), H272 (= H285), G273 (= G286), R275 (= R288), D301 (= D318), S302 (≠ G319), G303 (= G320), R305 (= R322), G324 (= G341), R325 (= R342)
2a85A Crystal structure of the g81a mutant of the active chimera of (s)- mandelate dehydrogenase in complex with its substrate 2- hydroxyoctanoate (see paper)
33% identity, 96% coverage: 15:388/389 of query aligns to 4:352/353 of 2a85A
- active site: S105 (= S116), Y128 (= Y139), T153 (≠ L165), D155 (= D167), K228 (= K261), H252 (= H285)
- binding flavin mononucleotide: Y23 (= Y34), P76 (= P87), T77 (≠ I88), A78 (≠ G89), S105 (= S116), Q126 (= Q137), Y128 (= Y139), T153 (≠ L165), K228 (= K261), H252 (= H285), G253 (= G286), R255 (= R288), D281 (= D318), S282 (≠ G319), G283 (= G320), R285 (= R322), G304 (= G341), R305 (= R342)
- binding (2s)-2-hydroxyoctanoic acid: Y128 (= Y139), N159 (≠ F171), G160 (= G172), R162 (= R174), H252 (= H285), R255 (= R288)
2a7pA Crystal structure of the g81a mutant of the active chimera of (s)- mandelate dehydrogenase in complex with its substrate 3-indolelactate (see paper)
33% identity, 96% coverage: 15:388/389 of query aligns to 4:352/353 of 2a7pA
- active site: S105 (= S116), Y128 (= Y139), T153 (≠ L165), D155 (= D167), K228 (= K261), H252 (= H285)
- binding 3-(indol-3-yl) lactate: Y128 (= Y139), R162 (= R174), H252 (= H285)
- binding flavin mononucleotide: Y23 (= Y34), P76 (= P87), T77 (≠ I88), A78 (≠ G89), S105 (= S116), Q126 (= Q137), Y128 (= Y139), T153 (≠ L165), K228 (= K261), H252 (= H285), G253 (= G286), R255 (= R288), D281 (= D318), S282 (≠ G319), G283 (= G320), R285 (= R322), G304 (= G341), R305 (= R342)
5zzqA The crystal structure of mandelate oxidase with (s)-4-hydroxymandelic acid (see paper)
30% identity, 94% coverage: 13:379/389 of query aligns to 1:342/355 of 5zzqA
- active site: Y126 (= Y139), D154 (= D167), H250 (= H285)
- binding flavin mononucleotide: P75 (= P87), V76 (≠ I88), A77 (≠ G89), Q124 (= Q137), Y126 (= Y139), T152 (≠ L165), K226 (= K261), H250 (= H285), R253 (= R288), D281 (= D318), G283 (= G320), R285 (= R322), G304 (= G341), R305 (= R342)
- binding (2S)-hydroxy(4-hydroxyphenyl)ethanoic acid: L106 (≠ V118), Y126 (= Y139), M158 (≠ F171), R161 (= R174), T200 (≠ M234), F204 (= F238), H250 (= H285), R253 (= R288)
6a24A The crystal structure of mandelate oxidase with 3-fluoropyruvate (see paper)
30% identity, 94% coverage: 13:379/389 of query aligns to 1:342/354 of 6a24A
- active site: Y126 (= Y139), D154 (= D167), H250 (= H285)
- binding flavin mononucleotide: P75 (= P87), V76 (≠ I88), A77 (≠ G89), Q124 (= Q137), Y126 (= Y139), T152 (≠ L165), K226 (= K261), H250 (= H285), G251 (= G286), R253 (= R288), D281 (= D318), G282 (= G319), G283 (= G320), R285 (= R322), G304 (= G341), R305 (= R342)
- binding pyruvic acid: R161 (= R174), H250 (= H285), R253 (= R288)
6a08A The crystal structure of mandelate oxidase with benzoyl-formic acid (see paper)
30% identity, 94% coverage: 13:379/389 of query aligns to 2:322/335 of 6a08A
- active site: Y127 (= Y139), D155 (= D167), H230 (= H285)
- binding benzoyl-formic acid: A78 (≠ G89), Y127 (= Y139), V156 (= V168), W158 (≠ A170), M159 (≠ F171), M159 (≠ F171), F184 (= F197), H230 (= H285), R233 (= R288)
- binding flavin mononucleotide: P76 (= P87), V77 (≠ I88), A78 (≠ G89), Q125 (= Q137), Y127 (= Y139), T153 (≠ L165), K206 (= K261), H230 (= H285), G231 (= G286), R233 (= R288), D261 (= D318), G263 (= G320), R265 (= R322), G284 (= G341), R285 (= R342)
- binding magnesium ion: D261 (= D318), G262 (= G319), I264 (= I321), L282 (≠ F339)
5zztA The crystal structure of mandelate oxidase with 3,3-difluoro-2- hydroxy-3-phenylpropionic acid (see paper)
30% identity, 94% coverage: 13:379/389 of query aligns to 1:319/331 of 5zztA
- active site: Y126 (= Y139), D154 (= D167), H227 (= H285)
- binding (2R)-3,3-difluoro-2-hydroxy-3-phenylpropanoic acid: F22 (≠ Y34), Y126 (= Y139), M158 (≠ F171), R161 (= R174), H227 (= H285), R230 (= R288)
- binding flavin mononucleotide: P75 (= P87), V76 (≠ I88), A77 (≠ G89), Q124 (= Q137), Y126 (= Y139), T152 (≠ L165), K203 (= K261), H227 (= H285), G228 (= G286), R230 (= R288), D258 (= D318), G259 (= G319), G260 (= G320), R262 (= R322), G281 (= G341), R282 (= R342)
6a1wA Mandelate oxidase with the enoyl fmn epoxide adduct (see paper)
30% identity, 94% coverage: 13:379/389 of query aligns to 2:321/334 of 6a1wA
- active site: Y127 (= Y139), D155 (= D167), H229 (= H285)
- binding 1-[(1aR,11R)-11-acetyl-8,9-dimethyl-2,4-dioxo-3,4-dihydrobenzo[g]oxazireno[3,2-e]pteridin-11-ium-6(2H)-yl]-1-deoxy-5-O-phosphono-D-ribitol: L24 (= L35), A75 (≠ S86), P76 (= P87), V77 (≠ I88), Q125 (= Q137), Y127 (= Y139), T153 (≠ L165), R162 (= R174), K205 (= K261), H229 (= H285), R232 (= R288), D260 (= D318), G262 (= G320), R264 (= R322), G283 (= G341), R284 (= R342)
- binding magnesium ion: D260 (= D318), G261 (= G319), I263 (= I321), L281 (≠ F339)
6a00A The crystal structure of mandelate oxidase with (s)-2-phenylpropionate (see paper)
30% identity, 94% coverage: 13:379/389 of query aligns to 2:321/334 of 6a00A
- active site: Y127 (= Y139), D155 (= D167), H229 (= H285)
- binding (2~{S})-2-phenylpropanoic acid: L107 (≠ V118), Y127 (= Y139), M159 (≠ F171), H229 (= H285), R232 (= R288)
- binding flavin mononucleotide: P76 (= P87), V77 (≠ I88), A78 (≠ G89), Q125 (= Q137), Y127 (= Y139), T153 (≠ L165), K205 (= K261), H229 (= H285), R232 (= R288), D260 (= D318), G262 (= G320), R264 (= R322), G283 (= G341), R284 (= R342)
- binding magnesium ion: D260 (= D318), G261 (= G319), I263 (= I321), L281 (≠ F339)
5zzrA The crystal structure of mandelate oxidase with (s)-mandelic acid (see paper)
30% identity, 94% coverage: 13:379/389 of query aligns to 2:321/334 of 5zzrA
- active site: Y127 (= Y139), D155 (= D167), H229 (= H285)
- binding flavin mononucleotide: P76 (= P87), V77 (≠ I88), A78 (≠ G89), Q125 (= Q137), Y127 (= Y139), T153 (≠ L165), K205 (= K261), H229 (= H285), R232 (= R288), D260 (= D318), G262 (= G320), R264 (= R322), G283 (= G341), R284 (= R342)
- binding (s)-mandelic acid: V44 (≠ I55), L107 (≠ V118), Y127 (= Y139), M159 (≠ F171), R162 (= R174), H229 (= H285), R232 (= R288), E242 (≠ N298)
Sites not aligning to the query:
6a1aA Mandelate oxidase mutant-y128f with 4-hydroxymandelic acid (see paper)
29% identity, 94% coverage: 13:379/389 of query aligns to 2:322/335 of 6a1aA
- active site: F127 (≠ Y139), D155 (= D167), H230 (= H285)
- binding flavin mononucleotide: P76 (= P87), V77 (≠ I88), A78 (≠ G89), Q125 (= Q137), F127 (≠ Y139), T153 (≠ L165), K206 (= K261), H230 (= H285), R233 (= R288), D261 (= D318), G263 (= G320), R265 (= R322), G284 (= G341), R285 (= R342)
- binding (2S)-hydroxy(4-hydroxyphenyl)ethanoic acid: A40 (≠ D51), R43 (≠ N54), L107 (≠ V118), F127 (≠ Y139), V156 (= V168), M159 (≠ F171), R162 (= R174), F184 (= F197), H230 (= H285), R233 (= R288), E243 (≠ N298)
Sites not aligning to the query:
6a01A The crystal structure of mandelate oxidase y128f with 3,3-difluoro-2, 2-dihydroxy-3-phenylpropionic acid (see paper)
29% identity, 94% coverage: 13:379/389 of query aligns to 1:321/333 of 6a01A
- active site: F126 (≠ Y139), D154 (= D167), H229 (= H285)
- binding 3,3-difluoro-2,2-dihydroxy-3-phenylpropanoic acid: F22 (≠ Y34), F126 (≠ Y139), M158 (≠ F171), R161 (= R174), H229 (= H285), R232 (= R288)
- binding flavin mononucleotide: P75 (= P87), V76 (≠ I88), A77 (≠ G89), Q124 (= Q137), F126 (≠ Y139), T152 (≠ L165), K205 (= K261), H229 (= H285), R232 (= R288), D260 (= D318), G262 (= G320), R264 (= R322), G283 (= G341), R284 (= R342)
6a36A Mandelate oxidase mutant-y128f with the 3-fluoropyruvic acid fmn adduct (see paper)
29% identity, 94% coverage: 13:379/389 of query aligns to 1:320/331 of 6a36A
- active site: F126 (≠ Y139), D154 (= D167), H228 (= H285)
- binding 1-{5-[(3S)-3-carboxy-4-fluoro-3-hydroxybutanoyl]-7,8-dimethyl-2,4-dioxo-1,3,4,5-tetrahydrobenzo[g]pteridin-10(2H)-yl}-1-deoxy-5-O-phosphono-D-ribitol: L23 (= L35), P75 (= P87), V76 (≠ I88), A77 (≠ G89), Q124 (= Q137), F126 (≠ Y139), T152 (≠ L165), M158 (≠ F171), R161 (= R174), K204 (= K261), H228 (= H285), R231 (= R288), D259 (= D318), G260 (= G319), G261 (= G320), R263 (= R322), G282 (= G341), R283 (= R342)
- binding 1-deoxy-1-{5-[(1S)-2-fluoro-1-hydroxyethyl]-7,8-dimethyl-2,4-dioxo-1,3,4,5-tetrahydrobenzo[g]pteridin-10(2H)-yl}-5-O-phosphono-D-ribitol: P75 (= P87), V76 (≠ I88), Q124 (= Q137), F126 (≠ Y139), T152 (≠ L165), K204 (= K261), H228 (= H285), R231 (= R288), D259 (= D318), G260 (= G319), G261 (= G320), R263 (= R322), G282 (= G341), R283 (= R342)
P0DUR7 FMN-dependent alpha-hydroxy acid dehydrogenase qulF; Quinolactacin A2 biosynthesis cluster protein F; EC 1.13.12.- from Penicillium citrinum (see paper)
32% identity, 91% coverage: 19:371/389 of query aligns to 33:373/402 of P0DUR7
- H289 (= H285) mutation to A: Blocks the formatin of 2-aminobenzoylacetamide.
5zbmB Structure of glycolate oxidase containing fmn from nicotiana benthamiana (see paper)
30% identity, 93% coverage: 12:371/389 of query aligns to 1:332/353 of 5zbmB
- active site: Y128 (= Y139), D156 (= D167), H248 (= H285)
- binding flavin mononucleotide: Y23 (= Y34), Y24 (≠ L35), P76 (= P87), T77 (≠ I88), W107 (≠ V118), Q126 (= Q137), Y128 (= Y139), T154 (≠ L165), K224 (= K261), H248 (= H285), G249 (= G286), R251 (= R288), D279 (= D318), G280 (= G319), R283 (= R322), G302 (= G341), R303 (= R342)
6gmcA 1.2 a resolution structure of human hydroxyacid oxidase 1 bound with fmn and 4-carboxy-5-[(4-chlorophenyl)sulfanyl]-1,2,3-thiadiazole
27% identity, 93% coverage: 11:371/389 of query aligns to 3:342/360 of 6gmcA
- active site: Y132 (= Y139), D160 (= D167), H258 (= H285)
- binding 5-[(4-chlorophenyl)sulfanyl]-1,2,3-thiadiazole-4-carboxylate: Y26 (= Y34), M82 (≠ L90), W110 (≠ V118), Y132 (= Y139), R167 (= R174), F191 (≠ P219), L203 (= L230), Y206 (≠ F233), H258 (= H285), R261 (= R288)
- binding flavin mononucleotide: Y26 (= Y34), Y27 (≠ L35), A79 (≠ P87), T80 (≠ I88), A81 (≠ G89), S108 (= S116), Q130 (= Q137), Y132 (= Y139), T158 (≠ L165), K234 (= K261), H258 (= H285), G259 (= G286), R261 (= R288), D289 (= D318), G290 (= G319), R293 (= R322), G312 (= G341), R313 (= R342)
Q9UJM8 2-Hydroxyacid oxidase 1; HAOX1; Glycolate oxidase; GO; GOX; Glyoxylate oxidase; EC 1.1.3.15; EC 1.2.3.5 from Homo sapiens (Human) (see 2 papers)
27% identity, 93% coverage: 11:371/389 of query aligns to 3:344/370 of Q9UJM8
6gmbA Structure of human hydroxyacid oxidase 1 bound with fmn and glycolate
27% identity, 93% coverage: 11:371/389 of query aligns to 3:344/362 of 6gmbA
- active site: Y132 (= Y139), D160 (= D167), H260 (= H285)
- binding flavin mononucleotide: Y26 (= Y34), Y27 (≠ L35), A79 (≠ P87), T80 (≠ I88), A81 (≠ G89), S108 (= S116), Q130 (= Q137), Y132 (= Y139), K236 (= K261), H260 (= H285), G261 (= G286), R263 (= R288), D291 (= D318), G292 (= G319), G293 (= G320), R295 (= R322), G314 (= G341), R315 (= R342)
- binding glycolic acid: Y26 (= Y34), W110 (≠ V118), Y132 (= Y139), R167 (= R174), H260 (= H285), R263 (= R288)
2rduA Crystal structure of human glycolate oxidase in complex with glyoxylate (see paper)
27% identity, 93% coverage: 11:371/389 of query aligns to 1:342/360 of 2rduA
- active site: S106 (= S116), Y130 (= Y139), T156 (≠ L165), D158 (= D167), K234 (= K261), H258 (= H285)
- binding flavin mononucleotide: Y24 (= Y34), Y25 (≠ L35), A77 (≠ P87), T78 (≠ I88), A79 (≠ G89), S106 (= S116), Q128 (= Q137), Y130 (= Y139), T156 (≠ L165), K234 (= K261), H258 (= H285), G259 (= G286), R261 (= R288), D289 (= D318), G290 (= G319), G291 (= G320), R293 (= R322), G312 (= G341), R313 (= R342)
- binding glyoxylic acid: Y24 (= Y34), W108 (≠ V118), Y130 (= Y139), R165 (= R174), H258 (= H285), R261 (= R288)
Query Sequence
>CA265_RS08335 FitnessBrowser__Pedo557:CA265_RS08335
MSKKIIFPYNPQFPSVADLRKKAKSRIPKFAFDYLEGGCNEGLNLSRNESDFDNIYLKPN
YLRVGGDIDMSVELFGRRYSAPFGISPIGLQGLMWPNAPEILARAAAKADIPYTLSTVST
SSIERIAEVSEGKAWFQLYHPTEDRLRDDILNRLKAVECPVLVVLVDVPAFGLRYKEIKS
GLSIPPKMSINNILQAFARPLWGIKTLQHGIPSFATLKPYMEKGMDMSQLGQFMNRTFTG
KVDIEKVSAIRDLWKGPLILKGITTDEDMQAAIQIGADGVIVSNHGGRQIDAGESSINSL
IKMTNNPIYKSKLKIMLDGGIRSGVDLARAHAVGSEFNFMGRPFMYGVGALGNEGGDHTI
NMFKTHLYQIMQQLTIEKITQFPDRLLNP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory