Comparing CA265_RS08340 FitnessBrowser__Pedo557:CA265_RS08340 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 1 hits to proteins with known functional sites (download)
4dlfA Crystal structure of an amidohydrolase (cog3618) from burkholderia multivorans (target efi-500235) with bound zn, space group p3221
35% identity, 100% coverage: 2:273/273 of query aligns to 4:286/287 of 4dlfA
>CA265_RS08340 FitnessBrowser__Pedo557:CA265_RS08340
MIDTHVHFWNFDPVRDSWINEEMPAIRHDFSPKDLTAVYHDLQITGCIAVQASQSEEENR
FLLSLAEENEMVKGIVGWVDLLDPNLDERLTYWSNFKKIKGWRHILQAENADFILNKKFI
AGVNLLKKYHYTYDLLCYHDQLADIIKMVDQIPDQPFVLDHCGKPDVKSQEIKSWSENIK
ILAANPNVLCKVSGLLTEADWKKWTEKELFNCFDVVFEHFGTERIMYGSDWPVVLLSRPY
QDWFNLVTKYTGQFSAAEKKLIFSDNAKAFYGV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory