Comparing CA265_RS08350 FitnessBrowser__Pedo557:CA265_RS08350 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8gstC Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Pyruvate bound-form) (see paper)
50% identity, 99% coverage: 2:281/284 of query aligns to 7:281/290 of 8gstC
8gsrA Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Apo-form) (see paper)
50% identity, 99% coverage: 2:281/284 of query aligns to 7:281/290 of 8gsrA
8skyB Crystal structure of yisk from bacillus subtilis in complex with oxalate (see paper)
41% identity, 75% coverage: 61:273/284 of query aligns to 81:295/303 of 8skyB
8sutA Crystal structure of yisk from bacillus subtilis in complex with reaction product 4-hydroxy-2-oxoglutaric acid (see paper)
41% identity, 75% coverage: 61:273/284 of query aligns to 82:296/303 of 8sutA
6iymA Fumarylacetoacetate hydrolase (eafah) from psychrophilic exiguobacterium antarcticum (see paper)
39% identity, 99% coverage: 1:280/284 of query aligns to 2:276/277 of 6iymA
6v77B Crystal structure of a putative hpce protein from mycobacterium smegmatis
38% identity, 87% coverage: 29:276/284 of query aligns to 21:273/279 of 6v77B
6sbiA X-ray structure of murine fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate (see paper)
38% identity, 73% coverage: 73:279/284 of query aligns to 14:214/216 of 6sbiA
3qdfA Crystal structure of 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from mycobacterium marinum (see paper)
43% identity, 74% coverage: 63:273/284 of query aligns to 56:242/252 of 3qdfA
6j5xB Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
41% identity, 71% coverage: 70:272/284 of query aligns to 67:270/280 of 6j5xB
6j5xA Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
41% identity, 71% coverage: 70:272/284 of query aligns to 67:270/280 of 6j5xA
6fogA X-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate at 1.94a resolution. (see paper)
39% identity, 70% coverage: 73:271/284 of query aligns to 15:207/218 of 6fogA
Sites not aligning to the query:
Q6P587 Acylpyruvase FAHD1, mitochondrial; Fumarylacetoacetate hydrolase domain-containing protein 1; FAH domain-containing protein 1; Oxaloacetate decarboxylase; OAA decarboxylase; YisK-like protein; EC 3.7.1.5; EC 4.1.1.112 from Homo sapiens (Human) (see 3 papers)
39% identity, 70% coverage: 73:271/284 of query aligns to 20:212/224 of Q6P587
1gttA Crystal structure of hpce (see paper)
42% identity, 65% coverage: 65:248/284 of query aligns to 216:392/421 of 1gttA
3r6oA Crystal structure of a probable 2-hydroxyhepta-2,4-diene-1, 7- dioateisomerase from mycobacterium abscessus (see paper)
32% identity, 97% coverage: 1:275/284 of query aligns to 3:257/265 of 3r6oA
4dbhA Crystal structure of cg1458 with inhibitor (see paper)
39% identity, 75% coverage: 59:272/284 of query aligns to 51:260/269 of 4dbhA
3v77A Crystal structure of a putative fumarylacetoacetate isomerase/hydrolase from oleispira antarctica (see paper)
41% identity, 62% coverage: 72:248/284 of query aligns to 17:197/224 of 3v77A
6jvwB Crystal structure of maleylpyruvate hydrolase from sphingobium sp. Syk-6 in complex with manganese (ii) ion and pyruvate (see paper)
36% identity, 87% coverage: 1:248/284 of query aligns to 1:238/264 of 6jvwB
6j5yA Crystal structure of fumarylpyruvate hydrolase from pseudomonas aeruginosa in complex with mn2+ and pyruvate (see paper)
33% identity, 71% coverage: 72:272/284 of query aligns to 25:224/233 of 6j5yA
1nkqA Crystal structure of yeast ynq8, a fumarylacetoacetate hydrolase family protein
35% identity, 68% coverage: 72:265/284 of query aligns to 10:219/247 of 1nkqA
3bqbX Hexagonal kristal form of 2-keto-3-deoxyarabinonate dehydratase (see paper)
28% identity, 63% coverage: 94:273/284 of query aligns to 112:281/291 of 3bqbX
>CA265_RS08350 FitnessBrowser__Pedo557:CA265_RS08350
MKLIRFGEAGAEKPGVIINDNYFDVSALVKDYNEEFFGGDGLEKLKTAVQSADLPQVDKG
VRLGPALARPSKIICVGLNYKDHAAETNAPIPSEPILFFKATSAIVGPNDDLIIPKNSKK
TDWEVELAIVIGKKASYVTEENALDHIAGYVLHNDYSEREFQIERNGQWVKGKSCDTFAP
IGPFIATQDEIADVHNLRLWLTVNGKTMQDGNTSNLIFNVPFMIAYISQFMTLLPGDVIT
TGTPAGVGLGQKPEPWYLKAGDVVELGIDGLGTSKQTAKAYSGN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory