Comparing CA265_RS08540 FitnessBrowser__Pedo557:CA265_RS08540 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7cwdA Crystal structure of beta-galactosidase ii from bacillus circulans in complex with beta-d-galactopyranosyl disaccharide (see paper)
45% identity, 99% coverage: 10:800/802 of query aligns to 3:801/803 of 7cwdA
5t99A Crystal structure of bugh2awt in complex with galactoisofagomine (see paper)
43% identity, 98% coverage: 11:798/802 of query aligns to 8:753/757 of 5t99A
7nitD X-ray structure of a multidomain bbgiii from bifidobacterium bifidum (see paper)
39% identity, 100% coverage: 2:800/802 of query aligns to 18:871/1253 of 7nitD
Sites not aligning to the query:
6qubA Truncated beta-galactosidase iii from bifidobacterium bifidum in complex with galactose
39% identity, 99% coverage: 4:800/802 of query aligns to 2:853/857 of 6qubA
5dmyA Beta-galactosidase - construct 33-930
39% identity, 100% coverage: 2:800/802 of query aligns to 2:851/855 of 5dmyA
6qudA 2-deoxy-galactose reaction intermediate of a truncated beta- galactosidase iii from bifidobacterium bifidum
38% identity, 99% coverage: 4:800/802 of query aligns to 2:833/837 of 6qudA
4cu8A Unravelling the multiple functions of the architecturally intricate streptococcus pneumoniae beta-galactosidase, bgaa (see paper)
39% identity, 99% coverage: 10:802/802 of query aligns to 15:846/848 of 4cu8A
4cu7A Unravelling the multiple functions of the architecturally intricate streptococcus pneumoniae beta-galactosidase, bgaa (see paper)
39% identity, 99% coverage: 10:802/802 of query aligns to 15:846/848 of 4cu7A
4cucA Unravelling the multiple functions of the architecturally intricate streptococcus pneumoniae beta-galactosidase, bgaa. (see paper)
39% identity, 99% coverage: 10:802/802 of query aligns to 15:846/847 of 4cucA
5t9gC Crystal structure of bugh2cwt in complex with galactoisofagomine (see paper)
33% identity, 98% coverage: 13:800/802 of query aligns to 3:810/811 of 5t9gC
6hpdA The structure of a beta-glucuronidase from glycoside hydrolase family 2 (see paper)
27% identity, 99% coverage: 4:800/802 of query aligns to 4:777/955 of 6hpdA
T2KN75 Beta-glucuronidase; Glycosyl hydrolase 2 family protein P17; P17_GH2; Polysaccharide utilization locus H protein P17; PUL H protein P17; EC 3.2.1.31 from Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) (see paper)
27% identity, 99% coverage: 4:800/802 of query aligns to 22:795/981 of T2KN75
6nzgA Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine (see paper)
28% identity, 82% coverage: 7:665/802 of query aligns to 1:647/837 of 6nzgA
6d50B Bacteroides uniforms beta-glucuronidase 2 bound to d-glucaro-1,5- lactone (see paper)
28% identity, 82% coverage: 7:665/802 of query aligns to 1:647/840 of 6d50B
5z1aA The crystal structure of bacteroides fragilis beta-glucuronidase in complex with uronic isofagomine
28% identity, 82% coverage: 8:662/802 of query aligns to 3:625/655 of 5z1aA
8dhlB Tannerella forsythia beta-glucuronidase (l2) (see paper)
26% identity, 82% coverage: 8:668/802 of query aligns to 2:649/853 of 8dhlB
Sites not aligning to the query:
8dhlA Tannerella forsythia beta-glucuronidase (l2) (see paper)
26% identity, 82% coverage: 8:668/802 of query aligns to 3:635/827 of 8dhlA
Sites not aligning to the query:
7kgzB Fmn-binding beta-glucuronidase from roseburia hominis (see paper)
24% identity, 85% coverage: 8:686/802 of query aligns to 2:624/634 of 7kgzB
6mvgA Crystal structure of fmn-binding beta-glucuronidase from ruminococcus gnavus (see paper)
25% identity, 85% coverage: 8:687/802 of query aligns to 1:631/637 of 6mvgA
6s6zA Structure of beta-galactosidase from thermotoga maritima (see paper)
27% identity, 58% coverage: 11:474/802 of query aligns to 39:484/1083 of 6s6zA
Sites not aligning to the query:
>CA265_RS08540 FitnessBrowser__Pedo557:CA265_RS08540
MTTVSTSRTRISFNKDWKFFLGDEPNAKSPAYNDIKWRKLTLPHDWSIEGKFDEKNPAKP
EGGGLPTGIGWYRKEFIAPANFKNRIINIEFDGVYKNSEVWINGHYLGKRPYGYSSFSYE
ISKFLKPGKNSIAVKVDNSAQPDSRWYSGSGIYRNVWLTSAAAVSVKRNGVFVKTTIISG
DKGQSVENRILSPGESMASIAVDIELENKFNTKGTYKILTTIFDDKGTKLQQKQWPMAVD
QNALKLVTNGLSIANPKLWSVEQPVMYKLLTEIMQADGKIIDSYTTAFGIRDFNFDAQKG
FSLNGKPMKILGVCLHHDLGALGAAVNVRAMERQLEIMKAMGVNAIRTAHNPPAPEFLDL
CDKMGFLVMDEAFDMWVKKKNKNDYHLNFPEWHKSDLEEMIKRDRNHPSIILWSIGNEIR
EQFDSTGVAITKELVGIVKNLDKTRPVISALTETKAEKNFIYQANALDIYGLNYNHKLYK
DFPENYPGVKFLATETTSALETRGFYDTADTIRRWPKDGKTKFTEGNSEWSASAYDNVSA
YWGSTHEETWAAAKKYDHVSGLFVWTGFDYLGEPLPYPWPARSSYFGIVDLAGFPKDSYY
MYQSEWTNKPVLHILPHWNWKQGKSVEVWAYYNNADEVELYLNGKSLGKRSKQGDDLHVL
WKVPFEPGTLKAVSRKNGKEVLVREMKTAGDPAKIELIADRKNIKADGKDLSFITVRILD
AAGNVVPNANNLVDFKVDGVGFIAGVDNGFQASIEPFKANYRKAFHGLCLAILQSTEKSG
EIKLTASSAGLASSSIIIKTGK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory