Comparing CA265_RS08565 FitnessBrowser__Pedo557:CA265_RS08565 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 15 hits to proteins with known functional sites (download)
B9JK80 D-apiose dehydrogenase; EC 1.1.1.420 from Rhizobium rhizogenes (strain K84 / ATCC BAA-868) (Agrobacterium radiobacter)
22% identity, 89% coverage: 31:350/360 of query aligns to 20:336/345 of B9JK80
Sites not aligning to the query:
5uiaA Crystal structure of an oxidoreductase from agrobacterium radiobacter in complex with NAD+, r-2,3-dihydroxyisovalerate and magnesium
22% identity, 89% coverage: 31:350/360 of query aligns to 17:333/342 of 5uiaA
Sites not aligning to the query:
5ui9A Crystal structure of an oxidoreductase from agrobacterium radiobacter in complex with NAD+, 2 -hydroxy-2-hydroxymethyl propanoic acid and magnesium
22% identity, 89% coverage: 31:350/360 of query aligns to 17:333/342 of 5ui9A
Sites not aligning to the query:
5uhzA Crystal structure of an oxidoreductase from agrobacterium radiobacter in complex with NAD+, d-apionate and magnesium
22% identity, 89% coverage: 31:350/360 of query aligns to 17:333/342 of 5uhzA
Sites not aligning to the query:
5uhwA Crystal structure of an oxidoreductase from agrobacterium radiobacter in complex with NAD+ and magnesium
22% identity, 89% coverage: 31:350/360 of query aligns to 17:333/342 of 5uhwA
Sites not aligning to the query:
1zh8A Crystal structure of oxidoreductase (tm0312) from thermotoga maritima at 2.50 a resolution
29% identity, 56% coverage: 20:219/360 of query aligns to 8:210/325 of 1zh8A
Sites not aligning to the query:
2glxA Crystal structure analysis of bacterial 1,5-af reductase (see paper)
26% identity, 69% coverage: 20:266/360 of query aligns to 5:252/332 of 2glxA
Sites not aligning to the query:
4koaA Crystal structure analysis of 1,5-anhydro-d-fructose reductase from sinorhizobium meliloti (see paper)
26% identity, 69% coverage: 20:266/360 of query aligns to 6:253/333 of 4koaA
Q2I8V6 1,5-anhydro-D-fructose reductase; Anhydrofructose reductase; 1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming); EC 1.1.1.292 from Ensifer adhaerens (Sinorhizobium morelense) (see paper)
26% identity, 69% coverage: 20:266/360 of query aligns to 6:253/333 of Q2I8V6
Sites not aligning to the query:
Q7JK39 Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; D-xylose 1-dehydrogenase; D-xylose-NADP dehydrogenase; Dimeric dihydrodiol dehydrogenase; Jmo2DD; EC 1.3.1.20; EC 1.1.1.179 from Macaca fuscata fuscata (Japanese macaque) (see paper)
27% identity, 33% coverage: 41:158/360 of query aligns to 30:147/334 of Q7JK39
Sites not aligning to the query:
Q9TQS6 Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; Cmo2DD; D-xylose 1-dehydrogenase; D-xylose-NADP dehydrogenase; Dimeric dihydrodiol dehydrogenase; EC 1.3.1.20; EC 1.1.1.179 from Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) (see paper)
27% identity, 33% coverage: 41:158/360 of query aligns to 30:147/334 of Q9TQS6
Sites not aligning to the query:
2poqX Dimeric dihydrodiol dehydrogenase complexed with inhibitor, isoascorbic acid (see paper)
27% identity, 33% coverage: 41:158/360 of query aligns to 29:146/331 of 2poqX
Sites not aligning to the query:
2o4uX Crystal structure of mammalian dimeric dihydrodiol dehydrogenase (see paper)
27% identity, 33% coverage: 41:158/360 of query aligns to 29:146/331 of 2o4uX
Sites not aligning to the query:
B3TMR8 dTDP-3,4-didehydro-2,6-dideoxy-alpha-D-glucose 3-reductase; 3-ketoreductase; NADPH-dependent C3-ketoreductase; EC 1.1.1.384 from Actinomadura kijaniata (see paper)
27% identity, 43% coverage: 12:167/360 of query aligns to 4:161/332 of B3TMR8
Sites not aligning to the query:
3rc1A Crystal structure of kijd10, a 3-ketoreductase from actinomadura kijaniata incomplex with NADP and tdp-benzene (see paper)
27% identity, 41% coverage: 20:167/360 of query aligns to 7:154/325 of 3rc1A
Sites not aligning to the query:
>CA265_RS08565 FitnessBrowser__Pedo557:CA265_RS08565
MSIEIKYKPDLPETKQPIIIIGAGGIVGDAHLPAYKIAGFEVHGIVNRTKERAQKLADTF
GILNVYNSVAEAVKLAPANAVYDLTIMPEQYIETLKQLPDGSAVLIQKPMGDDFTQAKEI
LELCRAKNLKAAINFQLRFAPFVSAAKYLIDKGLIGELYDMEVRVTVKTPWEIFPHVIIH
PRLEIQYHSIHYVDLIRSFLGNPESILAKTLKHPAKNLSSSRSTILFDYGDTMHAVINTN
HDHDFGPNHQESYIKWEGTKGAIVAKIGLLMDYPHGVPDVFEYCIVEDGKQAAWQTVKLE
GSWFPEAFIGTMANLMRYNEGSAAILHTSVEDVIQTMAVVESAYQSSDIGGVKVKEQLNK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory