SitesBLAST
Comparing CA265_RS08605 FitnessBrowser__Pedo557:CA265_RS08605 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4gvxA Crystal structure of a short chain dehydrogenase homolog (target efi- 505321) from burkholderia multivorans, with bound NADP and l-fucose
53% identity, 99% coverage: 1:259/262 of query aligns to 1:257/258 of 4gvxA
- active site: G18 (= G18), S140 (= S142), T150 (= T152), Y153 (= Y155), K157 (≠ N159), W194 (= W196)
- binding beta-L-fucopyranose: N94 (= N95), S140 (= S142), K141 (= K143), Q147 (= Q149), Y153 (= Y155), A184 (= A186), E185 (= E187), Y191 (= Y193), W194 (= W196)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G14), S17 (≠ K17), G18 (= G18), I19 (= I19), R39 (= R39), H40 (≠ K40), E63 (= E64), L64 (= L65), N90 (= N91), I138 (= I140), S139 (≠ T141), S140 (= S142), Y153 (= Y155), K157 (≠ N159), P183 (≠ V185), V186 (≠ C188), T188 (= T190), L190 (≠ A192), Y191 (= Y193)
4gloA Crystal structure of a short chain dehydrogenase homolog (target efi- 505321) from burkholderia multivorans, with bound NAD
53% identity, 99% coverage: 1:259/262 of query aligns to 1:257/258 of 4gloA
- active site: G18 (= G18), S140 (= S142), T150 (= T152), Y153 (= Y155), K157 (≠ N159)
- binding nicotinamide-adenine-dinucleotide: G14 (= G14), I19 (= I19), A38 (≠ G38), R39 (= R39), V62 (≠ A63), E63 (= E64), L64 (= L65), N90 (= N91), A91 (= A92), I138 (= I140), S139 (≠ T141), S140 (= S142), Y153 (= Y155), K157 (≠ N159), P183 (≠ V185), V186 (≠ C188), L190 (≠ A192)
4gkbB Crystal structure of a short chain dehydrogenase homolog (target efi- 505321) from burkholderia multivorans, unliganded structure
53% identity, 99% coverage: 1:259/262 of query aligns to 1:257/258 of 4gkbB
A0A0H3KNE7 L-fucose dehydrogenase; EC 1.1.1.435 from Burkholderia multivorans (strain ATCC 17616 / 249) (see paper)
53% identity, 99% coverage: 1:259/262 of query aligns to 1:257/258 of A0A0H3KNE7
- S17 (≠ K17) binding
- I19 (= I19) binding
- R39 (= R39) binding
- H40 (≠ K40) binding
- E63 (= E64) binding
- L64 (= L65) binding
- N90 (= N91) binding
- N94 (= N95) binding
- S140 (= S142) binding
- K141 (= K143) binding
- Q147 (= Q149) binding
- Y153 (= Y155) binding ; binding
- K157 (≠ N159) binding
- A184 (= A186) binding
- E185 (= E187) binding
- V186 (≠ C188) binding
- T188 (= T190) binding
6ds1B Crystal structure of cj0485 dehydrogenase in complex with NADP+ (see paper)
45% identity, 99% coverage: 1:259/262 of query aligns to 1:257/260 of 6ds1B
- binding magnesium ion: I61 (≠ A63), D62 (≠ E64)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G14), K17 (= K17), G18 (= G18), I19 (= I19), S38 (≠ G38), R39 (= R39), D62 (≠ E64), L63 (= L65), N89 (= N91), A90 (= A92), I138 (= I140), V139 (≠ T141), S140 (= S142), Y153 (= Y155), K157 (≠ N159), P183 (≠ V185), A184 (= A186), V186 (≠ C188)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
34% identity, 95% coverage: 4:251/262 of query aligns to 4:241/244 of 4nbuB
- active site: G18 (= G18), N111 (= N115), S139 (= S142), Q149 (≠ T152), Y152 (= Y155), K156 (≠ N159)
- binding acetoacetyl-coenzyme a: D93 (≠ G97), K98 (≠ S102), S139 (= S142), N146 (≠ Q149), V147 (≠ G150), Q149 (≠ T152), Y152 (= Y155), F184 (≠ Y193), M189 (≠ E198), K200 (≠ E209)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G14), N17 (≠ K17), G18 (= G18), I19 (= I19), D38 (≠ E42), F39 (≠ D43), V59 (≠ A63), D60 (≠ E64), V61 (≠ L65), N87 (= N91), A88 (= A92), G89 (= G93), I90 (≠ V94), T137 (≠ I140), S139 (= S142), Y152 (= Y155), K156 (≠ N159), P182 (= P191), F184 (≠ Y193), T185 (≠ E194), T187 (≠ W196), M189 (≠ E198)
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
32% identity, 95% coverage: 3:252/262 of query aligns to 2:249/252 of 1vl8B
- active site: G17 (= G18), S143 (= S142), I154 (≠ T152), Y157 (= Y155), K161 (≠ N159)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G14), R16 (≠ K17), G17 (= G18), L18 (≠ I19), S37 (≠ G38), R38 (= R39), C63 (≠ A63), D64 (≠ E64), V65 (≠ L65), A91 (≠ N91), A92 (= A92), G93 (= G93), I94 (≠ V94), V114 (≠ K114), I141 (= I140), S143 (= S142), Y157 (= Y155), K161 (≠ N159), P187 (≠ E187), G188 (≠ C188), Y190 (= Y193), T192 (= T195), M194 (≠ I197), T195 (vs. gap)
1iy8A Crystal structure of levodione reductase (see paper)
33% identity, 95% coverage: 4:251/262 of query aligns to 1:253/258 of 1iy8A
- active site: G15 (= G18), S143 (= S142), Q153 (≠ T152), Y156 (= Y155), K160 (≠ N159)
- binding nicotinamide-adenine-dinucleotide: G11 (= G14), S14 (≠ K17), G15 (= G18), L16 (≠ I19), D35 (≠ G38), V36 (≠ R39), A62 (= A63), D63 (≠ E64), V64 (≠ L65), N90 (= N91), G92 (= G93), I93 (≠ V94), T141 (≠ I140), S143 (= S142), Y156 (= Y155), K160 (≠ N159), P186 (≠ V185), G187 (≠ A186), T191 (= T190), P192 (= P191), M193 (≠ A192)
Q9LBG2 Levodione reductase; (6R)-2,2,6-trimethyl-1,4-cyclohexanedione reductase; EC 1.1.1.- from Leifsonia aquatica (Corynebacterium aquaticum) (see paper)
33% identity, 95% coverage: 4:251/262 of query aligns to 10:262/267 of Q9LBG2
- 17:42 (vs. 11:36, 38% identical) binding
- E103 (≠ N95) mutation E->A,D,N,Q: 26-fold increase in Km and a much lower enantiomeric excess of the reaction products.
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
32% identity, 95% coverage: 3:251/262 of query aligns to 4:239/243 of 4i08A
- active site: G19 (= G18), N113 (= N115), S141 (= S142), Q151 (≠ T152), Y154 (= Y155), K158 (≠ N159)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G14), S17 (≠ A16), R18 (≠ K17), I20 (= I19), T40 (≠ R39), N62 (≠ F61), V63 (= V62), N89 (= N91), A90 (= A92), G140 (≠ T141), S141 (= S142), Y154 (= Y155), K158 (≠ N159), P184 (= P191), G185 (≠ A192), T189 (= T199)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
32% identity, 95% coverage: 3:251/262 of query aligns to 1:242/248 of Q9KJF1
- M1 (≠ L3) modified: Initiator methionine, Removed
- S15 (≠ K17) binding
- D36 (≠ G38) binding
- D62 (≠ E64) binding
- I63 (≠ L65) binding
- N89 (= N91) binding
- Y153 (= Y155) binding
- K157 (≠ N159) binding
4iiuA Crystal structure of a putative 3-oxoacyl-[acyl-carrier protein]reductase from escherichia coli strain cft073 complexed with NADP+ at 2.1 a resolution
31% identity, 94% coverage: 7:253/262 of query aligns to 2:243/243 of 4iiuA
- active site: G13 (= G18), S140 (= S142), Y153 (= Y155), K157 (≠ N159)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G9 (= G14), S11 (≠ A16), K12 (= K17), G13 (= G18), I14 (= I19), H32 (≠ I36), H34 (≠ G38), D36 (≠ K40), D60 (≠ E64), V61 (≠ L65), N87 (= N91), A88 (= A92), G89 (= G93), I90 (≠ V94), S140 (= S142), Y153 (= Y155), K157 (≠ N159), P183 (= P191), G184 (≠ A192), I186 (= I197), T188 (= T199), M190 (vs. gap), I191 (≠ L200)
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
32% identity, 94% coverage: 5:251/262 of query aligns to 2:241/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G14), M16 (≠ I19), D35 (≠ G38), I36 (≠ R39), I62 (≠ L65), N88 (= N91), G90 (= G93), I138 (= I140), S140 (= S142), Y152 (= Y155), K156 (≠ N159), I185 (≠ C188)
3ijrF 2.05 angstrom resolution crystal structure of a short chain dehydrogenase from bacillus anthracis str. 'Ames ancestor' in complex with NAD+
32% identity, 95% coverage: 4:253/262 of query aligns to 43:287/290 of 3ijrF
- active site: G57 (= G18), S182 (= S142), L192 (≠ T152), Y195 (= Y155), K199 (≠ N159), K240 (≠ E205)
- binding magnesium ion: D55 (≠ A16), S56 (≠ K17), E80 (≠ K40)
- binding nicotinamide-adenine-dinucleotide: D55 (≠ A16), S56 (≠ K17), G57 (= G18), I58 (= I19), Y77 (≠ V37), L78 (≠ G38), E80 (≠ K40), G103 (≠ A63), D104 (≠ E64), L105 (= L65), N131 (= N91), V132 (vs. gap), A133 (= A92), Q134 (≠ G93), I155 (≠ K114), T180 (≠ I140), S182 (= S142), Y195 (= Y155), K199 (≠ N159), P225 (≠ V185), G226 (≠ A186), P227 (≠ E187), I228 (≠ C188), T230 (= T190), L232 (≠ A192)
Sites not aligning to the query:
3i3oA 2.06 angstrom resolution crystal structure of a short chain dehydrogenase from bacillus anthracis str. 'Ames ancestor' in complex with NAD-acetone
32% identity, 95% coverage: 4:253/262 of query aligns to 35:279/282 of 3i3oA
- active site: G49 (= G18), S174 (= S142), L184 (≠ T152), Y187 (= Y155), K191 (≠ N159), K232 (≠ E205)
- binding magnesium ion: D47 (≠ A16), S48 (≠ K17), E72 (≠ K40)
- binding nicotinamide adenine dinucleotide acetone adduct: G45 (= G14), D47 (≠ A16), S48 (≠ K17), G49 (= G18), I50 (= I19), Y69 (≠ V37), L70 (≠ G38), E72 (≠ K40), G95 (≠ A63), D96 (≠ E64), L97 (= L65), N123 (= N91), V124 (vs. gap), A125 (= A92), Q126 (≠ G93), Q127 (≠ V94), I147 (≠ K114), T172 (≠ I140), S174 (= S142), Y187 (= Y155), K191 (≠ N159), P217 (≠ V185), G218 (≠ A186), I220 (≠ C188), T222 (= T190), L224 (≠ A192)
5t2uA Short chain dehydrogenase/reductase family protein (see paper)
33% identity, 95% coverage: 3:251/262 of query aligns to 2:237/241 of 5t2uA
- active site: G17 (= G18), T135 (≠ S142), T145 (= T152), Y148 (= Y155), K152 (≠ N159)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G14), G17 (= G18), R38 (= R39), D39 (≠ K40), R42 (≠ D43), D60 (≠ E64), L61 (= L65), N83 (= N91), A84 (= A92), Y87 (≠ N95), I133 (= I140), T135 (≠ S142), Y148 (= Y155), K152 (≠ N159), P178 (≠ V185), P180 (≠ E187), T181 (≠ C188), T183 (= T190), T185 (≠ E198), T186 (= T199)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
31% identity, 96% coverage: 1:252/262 of query aligns to 1:252/255 of 5itvA
- active site: G18 (= G18), S141 (= S142), Y154 (= Y155), K158 (≠ N159)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G14), S17 (≠ K17), G18 (= G18), I19 (= I19), D38 (≠ G38), I39 (≠ R39), T61 (≠ A63), I63 (≠ L65), N89 (= N91), G91 (= G93), T139 (≠ I140), S141 (= S142), Y154 (= Y155), K158 (≠ N159), P184 (≠ V185), G185 (≠ A186), I186 (≠ E187), I187 (≠ C188)
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
31% identity, 95% coverage: 3:251/262 of query aligns to 4:243/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G14), S17 (≠ A16), R18 (≠ K17), I20 (= I19), T40 (≠ R39), N62 (≠ F61), V63 (= V62), N89 (= N91), A90 (= A92), I92 (≠ V94), V139 (≠ I140), S141 (= S142), Y154 (= Y155), K158 (≠ N159), P184 (= P191), G185 (≠ A192), I187 (vs. gap), T189 (= T195), M191 (≠ I197)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
33% identity, 93% coverage: 8:251/262 of query aligns to 5:243/246 of 3osuA
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
30% identity, 95% coverage: 3:251/262 of query aligns to 1:240/244 of P0AEK2
- GASR 12:15 (≠ GAAK 14:17) binding
- T37 (≠ A41) binding
- NV 59:60 (≠ EL 64:65) binding
- N86 (= N91) binding
- Y151 (= Y155) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (≠ YAAAN 155:159) binding
- A154 (= A158) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (≠ N159) mutation to A: Defect in the affinity for NADPH.
- I184 (≠ E194) binding
- E233 (≠ Q244) mutation to K: Decreases in the thermolability of the reductase; when associated with T-154.
Query Sequence
>CA265_RS08605 FitnessBrowser__Pedo557:CA265_RS08605
MDLQLKEKVIVITGAAKGIGRSIAEVFAKENAIAVIVGRKAEDNQIVVDAIATNGGKAAQ
FVAELSNPEDCETVVKNIVAQFGRIDGLVNNAGVNDGVGLESGNYKDFMASLHKNVVHYY
LMAHHVLPELIKSKGAIVNITSKTAETGQGNTSAYAAANGGRNALTREWAVELLKYGIRV
NAVVVAECWTPAYETWIETLDNAEEKLKEITAKIPLENRMTTAEEIANMTAFLMSSKSSH
TTGQIIHVDGGYVHLDRALANA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory