SitesBLAST
Comparing CA265_RS08650 FitnessBrowser__Pedo557:CA265_RS08650 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4bmsF Short chain alcohol dehydrogenase from ralstonia sp. Dsm 6428 in complex with NADPH
38% identity, 99% coverage: 1:245/248 of query aligns to 1:247/249 of 4bmsF
- active site: S137 (= S135), H147 (≠ S145), Y150 (= Y148), K154 (= K152), Q195 (≠ E193)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G13), N15 (= N15), S16 (= S16), I18 (= I18), R38 (= R38), R39 (= R39), A59 (= A57), D60 (= D58), V61 (≠ Q59), N87 (= N85), S88 (≠ A86), G89 (= G87), V110 (≠ I108), S137 (= S135), Y150 (= Y148), K154 (= K152), G181 (= G179), I183 (= I181), T185 (= T183), I187 (= I185)
6ihhA Crystal structure of rasadh f12 from ralstonia.Sp in complex with NADPH and a6o
38% identity, 99% coverage: 1:245/248 of query aligns to 1:247/249 of 6ihhA
- binding (2R,3S)-2-ethyl-2-[(2E)-2-(6-methoxy-3,4-dihydro-2H-naphthalen-1-ylidene)ethyl]-3-oxidanyl-cyclopentan-1-one: S137 (= S135), H147 (≠ S145), Y150 (= Y148), L188 (≠ M186), L246 (≠ M244)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G13), N15 (= N15), S16 (= S16), G17 (= G17), I18 (= I18), R38 (= R38), R39 (= R39), D60 (= D58), V61 (≠ Q59), N87 (= N85), S88 (≠ A86), G89 (= G87), V110 (≠ I108), T135 (≠ L133), S137 (= S135), Y150 (= Y148), K154 (= K152), P180 (= P178), G181 (= G179), A182 (≠ P180), I183 (= I181), T185 (= T183), S187 (≠ I185)
4esoB Crystal structure of a putative oxidoreductase protein from sinorhizobium meliloti 1021 in complex with NADP
38% identity, 99% coverage: 3:247/248 of query aligns to 2:247/251 of 4esoB
- active site: G16 (= G17), S136 (= S135), M146 (≠ S145), Y149 (= Y148), K153 (= K152)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), T14 (≠ N15), H15 (≠ S16), M17 (≠ I18), R37 (= R38), N38 (≠ R39), N41 (≠ A42), S58 (≠ A57), D59 (= D58), I60 (≠ Q59), N86 (= N85), A87 (= A86), G88 (= G87), T134 (≠ L133), S136 (= S135), Y149 (= Y148), P179 (= P178), G180 (= G179), I182 (= I181), T184 (= T183), T186 (≠ I185), K187 (≠ M186), G188 (≠ N187)
P50162 Tropinone reductase 1; Tropine dehydrogenase; Tropinone reductase I; TR-I; EC 1.1.1.206 from Datura stramonium (Jimsonweed) (Common thornapple) (see paper)
37% identity, 98% coverage: 4:245/248 of query aligns to 19:268/273 of P50162
- 25:49 (vs. 10:34, 60% identical) binding
- S158 (= S135) binding
- Y171 (= Y148) active site, Proton acceptor
1ae1B Tropinone reductase-i complex with NADP (see paper)
37% identity, 98% coverage: 3:245/248 of query aligns to 3:253/258 of 1ae1B
- active site: G17 (= G17), S143 (= S135), V153 (≠ S145), Y156 (= Y148), K160 (= K152)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G13), S15 (≠ N15), K16 (≠ S16), G17 (= G17), I18 (= I18), S37 (≠ G37), R38 (= R38), C62 (≠ A57), D63 (= D58), L64 (≠ Q59), N91 (= N85), A92 (= A86), S143 (= S135), Y156 (= Y148), K160 (= K152), P186 (= P178), I189 (= I181), T191 (= T183), L193 (≠ I185), V194 (≠ M186)
5fffA Noroxomaritidine/norcraugsodine reductase in complex with NADP+ and piperonal (see paper)
36% identity, 98% coverage: 3:246/248 of query aligns to 8:255/257 of 5fffA
- active site: K206 (= K188)
- binding 1,3-benzodioxole-5-carbaldehyde: Y100 (≠ V89), H158 (≠ S145)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G13), T20 (≠ N15), G22 (= G17), I23 (= I18), R43 (= R38), C67 (≠ A57), D68 (= D58), V69 (≠ Q59), N96 (= N85), I146 (≠ L133), Y161 (= Y148), K165 (= K152), P191 (= P178), A193 (≠ P180), I194 (= I181), T196 (= T183), G198 (vs. gap), T199 (vs. gap)
5ff9B Noroxomaritidine/norcraugsodine reductase in complex with NADP+ and tyramine (see paper)
36% identity, 98% coverage: 3:246/248 of query aligns to 8:255/257 of 5ff9B
- active site: K206 (= K188)
- binding 4-(2-aminoethyl)phenol: Y100 (≠ V89), I155 (≠ G142), H158 (≠ S145)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G13), T20 (≠ N15), K21 (≠ S16), I23 (= I18), S42 (≠ G37), R43 (= R38), C67 (≠ A57), D68 (= D58), V69 (≠ Q59), N96 (= N85), I146 (≠ L133), S148 (= S135), Y161 (= Y148), K165 (= K152), P191 (= P178), A193 (≠ P180), I194 (= I181), T196 (= T183), G198 (vs. gap), T199 (vs. gap)
A0A1A9TAK5 Noroxomaritidine/norcraugsodine reductase; NorRed; EC 1.1.1.- from Narcissus pseudonarcissus (Daffodil) (see paper)
36% identity, 98% coverage: 3:246/248 of query aligns to 8:255/257 of A0A1A9TAK5
P50163 Tropinone reductase 2; Tropinone reductase II; TR-II; EC 1.1.1.236 from Datura stramonium (Jimsonweed) (Common thornapple) (see paper)
34% identity, 98% coverage: 3:244/248 of query aligns to 6:254/260 of P50163
- 18:41 (vs. 15:38, 42% identical) binding
- S146 (= S135) binding
- IATSL 192:196 (≠ IATEI 181:185) binding
2ae2A Tropinone reductase-ii complexed with NADP+ and pseudotropine (see paper)
34% identity, 98% coverage: 3:244/248 of query aligns to 5:253/259 of 2ae2A
- active site: G19 (= G17), S145 (= S135), Y158 (= Y148), K162 (= K152)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G13), S17 (≠ N15), R18 (≠ S16), G19 (= G17), I20 (= I18), S39 (≠ G37), R40 (= R38), C64 (≠ A57), L66 (≠ Q59), N93 (= N85), G95 (= G87), I116 (= I108), I143 (≠ L133), S145 (= S135), Y158 (= Y148), K162 (= K152), P188 (= P178), G189 (= G179), V190 (≠ P180), I191 (= I181), T193 (= T183), S194 (≠ E184), L195 (≠ I185), V196 (≠ M186)
- binding pseudotropine: S145 (= S135), E155 (≠ S145), Y158 (= Y148), L195 (≠ I185)
1ipfA Tropinone reductase-ii complexed with NADPH and tropinone (see paper)
34% identity, 98% coverage: 3:244/248 of query aligns to 5:253/259 of 1ipfA
- active site: G19 (= G17), S145 (= S135), Y158 (= Y148), K162 (= K152)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G13), R18 (≠ S16), G19 (= G17), I20 (= I18), S39 (≠ G37), R40 (= R38), C64 (≠ A57), D65 (= D58), L66 (≠ Q59), N93 (= N85), S145 (= S135), Y158 (= Y148), K162 (= K152), P188 (= P178), V190 (≠ P180), I191 (= I181), T193 (= T183), S194 (≠ E184), L195 (≠ I185), V196 (≠ M186)
- binding 8-methyl-8-azabicyclo[3,2,1]octan-3-one: S147 (≠ T137), E155 (≠ S145), Y158 (= Y148)
1ipeA Tropinone reductase-ii complexed with NADPH (see paper)
34% identity, 98% coverage: 3:244/248 of query aligns to 5:253/259 of 1ipeA
- active site: G19 (= G17), S145 (= S135), Y158 (= Y148), K162 (= K152)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G13), S17 (≠ N15), R18 (≠ S16), G19 (= G17), I20 (= I18), S39 (≠ G37), R40 (= R38), C64 (≠ A57), D65 (= D58), L66 (≠ Q59), N93 (= N85), I116 (= I108), S145 (= S135), Y158 (= Y148), K162 (= K152), P188 (= P178), I191 (= I181), T193 (= T183), S194 (≠ E184), L195 (≠ I185), V196 (≠ M186)
7do7A Crystal structure of azotobacter vinelandii l-rhamnose 1- dehydrogenase(NAD and l-rhamnose bound-form) (see paper)
33% identity, 98% coverage: 2:244/248 of query aligns to 1:251/256 of 7do7A
- active site: G16 (= G17), S146 (= S135), Y159 (= Y148)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), R15 (≠ S16), G16 (= G17), I17 (= I18), S37 (≠ R38), D66 (= D58), A67 (≠ Q59), N93 (= N85), A94 (= A86), G95 (= G87), I96 (≠ V88), V144 (≠ L133), S145 (= S134), S146 (= S135), Y159 (= Y148), K163 (= K152), P189 (= P178), G190 (= G179), I192 (= I181), T194 (= T183), I196 (= I185)
- binding beta-L-rhamnopyranose: F99 (≠ Q91), S146 (= S135), S148 (≠ T137), Q156 (≠ S145), Y159 (= Y148), N197 (= N192), D235 (= D228), M236 (≠ A229), R238 (≠ T231)
7b81A Crystal structure of azotobacter vinelandii l-rhamnose 1-dehydrogenase (NAD bound-form) (see paper)
33% identity, 98% coverage: 2:244/248 of query aligns to 1:251/256 of 7b81A
- active site: G16 (= G17), S146 (= S135), Y159 (= Y148)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), S14 (≠ N15), R15 (≠ S16), I17 (= I18), D66 (= D58), A67 (≠ Q59), N93 (= N85), A94 (= A86), G95 (= G87), I96 (≠ V88), T116 (≠ I108), V144 (≠ L133), S146 (= S135), Y159 (= Y148), K163 (= K152), P189 (= P178), G190 (= G179), I192 (= I181), T194 (= T183), I196 (= I185)
3o4rA Crystal structure of human dehydrogenase/reductase (sdr family) member 4 (dhrs4)
35% identity, 97% coverage: 4:243/248 of query aligns to 6:249/254 of 3o4rA
- active site: G19 (= G17), S145 (= S135), F155 (≠ S145), Y158 (= Y148), K162 (= K152), K203 (≠ E193)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A15 (≠ G13), T17 (≠ N15), D18 (≠ S16), G19 (= G17), I20 (= I18), S39 (≠ G37), R40 (= R38), K41 (≠ R39), N44 (≠ A42), H65 (≠ D58), V66 (≠ Q59), N92 (= N85), A94 (≠ G87), S145 (= S135), Y158 (= Y148), K162 (= K152), P188 (= P178), G189 (= G179), L190 (≠ P180), I191 (= I181), T193 (= T183), F195 (≠ I185), S196 (≠ M186)
Q9BTZ2 Dehydrogenase/reductase SDR family member 4; NADPH-dependent carbonyl reductase; CR; NADPH-dependent retinol dehydrogenase/reductase; NRDR; humNRDR; Peroxisomal short-chain alcohol dehydrogenase; PSCD; SCAD-SRL; Short chain dehydrogenase/reductase family 25C member 2; Protein SDR25C2; Short-chain dehydrogenase/reductase family member 4; EC 1.1.1.184 from Homo sapiens (Human) (see 2 papers)
35% identity, 97% coverage: 4:243/248 of query aligns to 30:273/278 of Q9BTZ2
- S176 (≠ G142) Responsible for the stereoselective reduction of 3-ketosteroids into 3beta-hydroxysteroids and benzil into R-benzoin; mutation to F: Decreased reduction activity for benzil, isatin and retinal and increased activity for 5beta-Pregnane-3,20-dione and 5beta-Dihydrotestosterone. No change of stereoselectivity in 3-ketosteroids reduction and no change in 3beta-hydroxysteroid oxidation. Decreased reduction activity for isatin and increased activity for 5beta-Pregnane-3,20-dione, 5beta-Dihydrotestosterone, benzil and retinal; when associated with L-179. Change in stereoselective activity by the reduction of 5beta-Pregnane-3,20-dione predominantly to the 3alpha-hydroxysteroid; when associated with L-179. Switch from 3beta-hydroxysteroid to 3alpha-hydroxysteroid oxidation; when associated with L-179. Loss of cold catalytic inactivation; when associated with L-179 and N-195. Increased reduction activity for renital and oxidation activity for retinol; when associated with L-179 and N-195.
- F179 (≠ S145) Responsible for the stereoselective reduction of 3-ketosteroids into 3beta-hydroxysteroids and benzil into R-benzoin; mutation to L: Decreased reduction activity for isatin and increased activity for 5beta-Pregnane-3,20-dione, 5beta-Dihydrotestosterone, benzil and retinal; when associated with F-176. Change in stereoselective activity by the reduction of 5beta-Pregnane-3,20-dione predominantly to the 3alpha-hydroxysteroid; when associated with F-176. Switch from 3beta-hydroxysteroid to 3alpha-hydroxysteroid oxidation; when associated with F-176. Loss of cold catalytic inactivation; when associated with F-176 and N-195. Increased reduction activity for renital and oxidation activity for retinol; when associated with F-176 and N-195.
- T195 (≠ I161) mutation to N: Loss of cold catalytic inactivation. Loss of cold catalytic inactivation; when associated with F-176 and L-179. Switch in stereoselective activity from 3beta-hydroxysteroid to 3alpha-hydroxysteroid oxidation; when associated with F-176 and L-179. Increased reduction activity for renital and oxidation activity for retinol; when associated with F-176 and L-179.
7v0hG Crystal structure of putative glucose 1-dehydrogenase from burkholderia cenocepacia in complex with NADP and a potential reaction product
31% identity, 99% coverage: 1:245/248 of query aligns to 6:253/253 of 7v0hG
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G13), S20 (≠ N15), K21 (≠ S16), G22 (= G17), I23 (= I18), A43 (vs. gap), S44 (vs. gap), S45 (≠ T36), G68 (≠ A57), D69 (= D58), V70 (≠ Q59), N96 (= N85), S97 (≠ A86), G98 (= G87), Y100 (≠ V89), I144 (≠ L133), S146 (= S135), Y159 (= Y148), K163 (= K152), P189 (= P178), G190 (= G179), M191 (≠ P180), I192 (= I181), T194 (= T183), G196 (≠ I185), T197 (≠ M186)
- binding (2R)-2-(hydroxymethyl)pentanedioic acid: S146 (= S135), Y159 (= Y148), M191 (≠ P180), I202 (≠ L191)
6ci9D Rmm microcompartment-associated aminopropanol dehydrogenase NADP + aminoacetone holo-structure (see paper)
33% identity, 99% coverage: 1:246/248 of query aligns to 4:251/259 of 6ci9D
- active site: G20 (= G17), S145 (= S135), Y159 (= Y148)
- binding 1-aminopropan-2-one: F97 (≠ V89), S145 (= S135), T147 (= T137), W156 (vs. gap), Y159 (= Y148), G190 (= G179)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G16 (= G13), S18 (≠ N15), G20 (= G17), I21 (= I18), G40 (= G37), R41 (= R38), N42 (≠ R39), D66 (≠ L68), V67 (≠ A69), N93 (= N85), G95 (= G87), T143 (≠ L133), S145 (= S135), Y159 (= Y148), K163 (= K152), P189 (= P178), N191 (≠ P180), I192 (= I181), T194 (= T183), G196 (≠ I185), L197 (≠ M186)
5wuwA Serratia marcescens short-chain dehydrogenase/reductase f98l/f202l mutant (see paper)
34% identity, 98% coverage: 4:245/248 of query aligns to 3:244/245 of 5wuwA
- active site: G16 (= G17), S140 (= S134), Y154 (= Y148), L161 (= L155)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), R15 (≠ S16), I17 (= I18), Y36 (vs. gap), A37 (vs. gap), A38 (vs. gap), D63 (= D58), S64 (≠ Q59), N90 (= N85), A91 (= A86), G92 (= G87), Y154 (= Y148), K158 (= K152), G185 (= G179), P186 (= P180), V187 (≠ I181)
3pk0B Crystal structure of short-chain dehydrogenase/reductase sdr from mycobacterium smegmatis (see paper)
36% identity, 100% coverage: 1:247/248 of query aligns to 5:254/262 of 3pk0B
Query Sequence
>CA265_RS08650 FitnessBrowser__Pedo557:CA265_RS08650
MSNLTGKKALVTGGNSGIGYATAKELKAQGAEVIITGRRKDAVDKAAAELGVIGLVADQS
QITAIEGLASDVESIFNKIDILFINAGVVEQSSIAEATEKSFDTIFGINFKGAYFTLSKF
IPLMNDGSSVVFLSSNTAHMDGAKSSIYTSSKSALNSVMRIAAVELAPRQIRVNSVSPGP
IATEIMNKMGLNEEQLNGINQWLISRSPLGKIGKSEDVAKMVAFFCGDAATYITGAEIVM
DGGMSLKA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory