SitesBLAST
Comparing CA265_RS08870 FitnessBrowser__Pedo557:CA265_RS08870 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
P38117 Electron transfer flavoprotein subunit beta; Beta-ETF from Homo sapiens (Human) (see 10 papers)
33% identity, 82% coverage: 1:200/245 of query aligns to 4:209/255 of P38117
- A9 (≠ C6) binding
- NPFC 39:42 (≠ NPYD 36:39) binding
- C66 (≠ V62) binding
- 123:134 (vs. 114:125, 42% identical) binding
- D128 (= D119) to N: in GA2B; decreased protein stability; dbSNP:rs104894678
- T154 (≠ D145) to M: in dbSNP:rs1130426
- R164 (= R155) to Q: in GA2B; reduced electron transfer activity; dbSNP:rs104894677
- E165 (= E156) mutation E->A,Q: Drastically increases interprotein electron transfer rates.
- 183:205 (vs. 174:196, 26% identical) Recognition loop
- L195 (≠ M186) mutation to A: Severely impaired in complex formation with ACADM.
- K200 (≠ S191) modified: N6,N6,N6-trimethyllysine; by ETFBKMT; alternate; mutation to R: Does not abolish electron transfer activity. Decreases sensitivity to inhibition by lysine methyltransferase ETFBKMT.
- KAK 200:202 (≠ SAR 191:193) mutation to RAR: Does not abolish methylation by ETFBKMT.
- KAKK 200:203 (≠ SART 191:194) mutation to RAKR: Does not abolish electron transfer activity. Abolishes sensitivity to inhibition by lysine methyltransferase ETFBKMT.
- K203 (≠ T194) modified: N6,N6,N6-trimethyllysine; by ETFBKMT; mutation to R: Does not abolish electron transfer activity. Decreases sensitivity to inhibition by lysine methyltransferase ETFBKMT.
2a1uB Crystal structure of the human etf e165betaa mutant (see paper)
33% identity, 82% coverage: 1:200/245 of query aligns to 1:206/252 of 2a1uB
- binding adenosine monophosphate: A6 (≠ C6), V7 (≠ I7), K8 (≠ S8), C39 (≠ D39), C63 (≠ V62), V101 (= V95), L119 (≠ T113), G120 (= G114), Q122 (≠ E116), A123 (≠ S117), D126 (≠ Y120), C128 (≠ G122), N129 (= N123), Q130 (= Q124), T131 (≠ V125)
- binding flavin-adenine dinucleotide: P37 (= P37), L182 (≠ E176)
Q2TBV3 Electron transfer flavoprotein subunit beta; Beta-ETF from Bos taurus (Bovine) (see paper)
30% identity, 97% coverage: 1:238/245 of query aligns to 4:249/255 of Q2TBV3
- K200 (≠ S191) modified: N6,N6,N6-trimethyllysine; by ETFBKMT; alternate
- K203 (≠ T194) modified: N6,N6,N6-trimethyllysine; by ETFBKMT
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
Q9DCW4 Electron transfer flavoprotein subunit beta; Beta-ETF from Mus musculus (Mouse) (see paper)
29% identity, 100% coverage: 1:244/245 of query aligns to 4:255/255 of Q9DCW4
- K200 (≠ S191) modified: N6,N6,N6-trimethyllysine; by ETFBKMT; alternate
- K203 (≠ T194) modified: N6,N6,N6-trimethyllysine; by ETFBKMT
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
1efpB Electron transfer flavoprotein (etf) from paracoccus denitrificans (see paper)
32% identity, 80% coverage: 1:197/245 of query aligns to 1:203/246 of 1efpB
- binding adenosine monophosphate: P6 (≠ C6), V7 (≠ I7), D39 (= D39), I63 (≠ V62), V101 (= V95), A119 (≠ T113), G120 (= G114), Q122 (≠ E116), A123 (≠ S117), N126 (≠ Y120), M128 (≠ G122), N129 (= N123), T131 (≠ V125)
- binding flavin-adenine dinucleotide: Y13 (≠ T13), L182 (≠ E176)
5ol2B The electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile (see paper)
34% identity, 64% coverage: 1:158/245 of query aligns to 1:160/260 of 5ol2B
- binding flavin-adenine dinucleotide: C6 (= C6), I7 (= I7), K8 (≠ S8), D38 (= D39), M61 (≠ V62), A92 (≠ R90), D93 (= D91), T94 (≠ A92), T97 (≠ V95), A115 (≠ T113), G116 (= G114), A119 (≠ S117), G122 (≠ Y120), T124 (≠ G122), A125 (≠ N123), V127 (= V125)
6fahB Molecular basis of the flavin-based electron-bifurcating caffeyl-coa reductase reaction (see paper)
29% identity, 81% coverage: 1:199/245 of query aligns to 1:203/262 of 6fahB
- binding flavin-adenine dinucleotide: C6 (= C6), A7 (≠ I7), K8 (≠ S8), D38 (= D39), T61 (≠ N61), M62 (≠ V62), A93 (≠ R90), D94 (= D91), T95 (≠ A92), T98 (≠ V95), L102 (= L99), G118 (= G114), Q120 (≠ E116), G124 (≠ Y120), T126 (≠ G122), A127 (≠ N123), V129 (= V125)
Sites not aligning to the query:
4l2iB Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation (see paper)
34% identity, 84% coverage: 1:206/245 of query aligns to 1:208/263 of 4l2iB
- binding flavin-adenine dinucleotide: C6 (= C6), V7 (≠ I7), K8 (≠ S8), Y37 (= Y38), D38 (= D39), Y40 (≠ I41), T60 (≠ N61), M61 (≠ V62), A92 (= A92), D93 (≠ Y93), T94 (≠ F94), T97 (≠ K97), M101 (≠ E101), C116 (≠ T113), G117 (= G114), Q119 (≠ E116), A120 (≠ S117), G123 (≠ Y120), T125 (≠ G122), A126 (≠ N123), V128 (= V125)
- binding nicotinamide-adenine-dinucleotide: M61 (≠ V62), G62 (= G63), P63 (≠ E64), S85 (vs. gap), D86 (≠ N86), G91 (≠ D91)
4kpuB Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation (see paper)
34% identity, 84% coverage: 1:206/245 of query aligns to 1:208/263 of 4kpuB
- binding flavin-adenine dinucleotide: C6 (= C6), V7 (≠ I7), K8 (≠ S8), Y37 (= Y38), D38 (= D39), Y40 (≠ I41), M61 (≠ V62), A92 (= A92), D93 (≠ Y93), T94 (≠ F94), T97 (≠ K97), C116 (≠ T113), G117 (= G114), Q119 (≠ E116), A120 (≠ S117), G123 (≠ Y120), T125 (≠ G122), A126 (≠ N123), V128 (= V125)
5ow0B Crystal structure of an electron transfer flavoprotein from geobacter metallireducens (see paper)
30% identity, 99% coverage: 1:243/245 of query aligns to 1:246/251 of 5ow0B
- binding adenosine monophosphate: L6 (≠ C6), A7 (≠ I7), K8 (≠ S8), D39 (= D39), Y62 (≠ V62), I95 (≠ V95), A114 (≠ T113), G115 (= G114), Q117 (≠ E116), S118 (= S117), R123 (≠ G122), G124 (≠ N123), V125 (≠ Q124), V126 (= V125), P127 (≠ A126)
- binding flavin-adenine dinucleotide: L37 (≠ P37), Y38 (= Y38)
7qh2B Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
28% identity, 76% coverage: 2:187/245 of query aligns to 3:192/265 of 7qh2B
- binding flavin-adenine dinucleotide: C7 (= C6), K9 (≠ S8), D39 (= D39), M62 (≠ V62), D94 (= D91), V95 (≠ A92), L102 (= L99), G118 (= G114), Q120 (≠ E116), T121 (≠ S117), T126 (≠ G122), A127 (≠ N123), V129 (= V125)
P53570 Electron transfer flavoprotein subunit beta; Beta-ETF; Electron transfer flavoprotein small subunit; ETFSS from Methylophilus methylotrophus (Bacterium W3A1) (see paper)
30% identity, 80% coverage: 1:197/245 of query aligns to 1:205/264 of P53570
1o96A Structure of electron transferring flavoprotein for methylophilus methylotrophus. (see paper)
30% identity, 80% coverage: 1:197/245 of query aligns to 1:204/261 of 1o96A
- binding adenosine monophosphate: A6 (≠ C6), V7 (≠ I7), K8 (≠ S8), D38 (= D39), V63 (= V62), V99 (= V95), A117 (≠ T113), G118 (= G114), Q120 (≠ E116), S121 (= S117), Y126 (≠ G122), A127 (≠ N123), T129 (≠ V125)
- binding flavin-adenine dinucleotide: Q120 (≠ E116), Q182 (≠ A175)
7koeA Electron bifurcating flavoprotein fix/etfabcx (see paper)
29% identity, 80% coverage: 3:198/245 of query aligns to 4:210/282 of 7koeA
- binding flavin-adenine dinucleotide: C7 (= C6), I8 (= I7), K9 (≠ S8), D39 (= D39), M62 (≠ V62), A93 (vs. gap), D94 (vs. gap), T95 (vs. gap), T98 (≠ A88), L102 (≠ A92), T121 (= T113), G122 (= G114), A125 (≠ S117), G128 (≠ Y120), T130 (≠ G122), G131 (≠ N123), V133 (= V125)
Query Sequence
>CA265_RS08870 FitnessBrowser__Pedo557:CA265_RS08870
MKILVCISNVPDTTTKITFTNDNTEFNTSGVQYIVNPYDEIALSRAIELTEGGKGTVTVI
NVGEAGNDPTIRKALAIGADDAVRVNAAPRDAYFVAKQLAEYAKDKDFNLILTGRESIDY
NGNQVAAMVGEFLDIPSVSIIKKLDVDGDTATIEREIEGGKEVLTVSGKLVASCAEGVAE
PKIPNMRGIMSARTKPLVVVDAVAIEEVTKVTKYETPAPRGTVKLIPADQTESLISLLHS
EAKVI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory