SitesBLAST
Comparing CA265_RS09125 FitnessBrowser__Pedo557:CA265_RS09125 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5zaiC Crystal structure of 3-hydroxypropionyl-coa dehydratase from metallosphaera sedula (see paper)
33% identity, 93% coverage: 16:255/258 of query aligns to 17:253/259 of 5zaiC
- active site: A65 (= A64), F70 (≠ L69), S82 (= S84), R86 (≠ K88), G110 (= G112), E113 (≠ G115), P132 (≠ T134), E133 (= E135), I138 (≠ F140), P140 (= P142), G141 (≠ A143), A226 (≠ L227), F236 (≠ R238)
- binding coenzyme a: K24 (= K23), L25 (≠ K24), A63 (= A62), G64 (= G63), A65 (= A64), D66 (= D65), I67 (≠ L66), P132 (≠ T134), R166 (≠ I167), F248 (= F250), K251 (= K253)
3omeC Crystal structure of a probable enoyl-coa hydratase from mycobacterium smegmatis (see paper)
37% identity, 74% coverage: 7:196/258 of query aligns to 8:193/247 of 3omeC
- active site: H65 (≠ A64), E70 (≠ L69), A82 (≠ H86), L86 (= L90), G110 (= G112), L113 (≠ G115), V133 (≠ E135), I138 (≠ V141), G139 (≠ P142), E142 (≠ V145)
- binding zinc ion: E81 (≠ N85), E142 (≠ V145)
Sites not aligning to the query:
3q0jC Crystal structure of the mycobacterium tuberculosis crotonase in complex with the inhibitor acetoacetylcoa
29% identity, 97% coverage: 5:254/258 of query aligns to 6:250/255 of 3q0jC
- active site: A65 (= A64), M70 (≠ L69), T80 (≠ L87), F84 (= F91), G108 (= G112), E111 (≠ G115), P130 (≠ T134), E131 (= E135), V136 (≠ F140), P138 (= P142), G139 (≠ A143), L224 (≠ Q232), F234 (vs. gap)
- binding acetoacetyl-coenzyme a: Q23 (≠ E22), A24 (≠ K23), L25 (≠ K24), A27 (= A26), A63 (= A62), G64 (= G63), A65 (= A64), D66 (= D65), I67 (≠ L66), K68 (≠ A67), M70 (≠ L69), F84 (= F91), G107 (≠ A111), G108 (= G112), E111 (≠ G115), P130 (≠ T134), E131 (= E135), P138 (= P142), G139 (≠ A143), M140 (≠ I144)
3q0gC Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
29% identity, 97% coverage: 5:254/258 of query aligns to 6:250/255 of 3q0gC
- active site: A65 (= A64), M70 (≠ L69), T80 (≠ L87), F84 (= F91), G108 (= G112), E111 (≠ G115), P130 (≠ T134), E131 (= E135), V136 (≠ F140), P138 (= P142), G139 (≠ A143), L224 (≠ Q232), F234 (vs. gap)
- binding coenzyme a: L25 (≠ K24), A63 (= A62), I67 (≠ L66), K68 (≠ A67), Y104 (≠ H108), P130 (≠ T134), E131 (= E135), L134 (≠ I138)
3h81A Crystal structure of enoyl-coa hydratase from mycobacterium tuberculosis (see paper)
29% identity, 97% coverage: 5:254/258 of query aligns to 5:249/256 of 3h81A
- active site: A64 (= A64), M69 (≠ L69), T79 (≠ L87), F83 (= F91), G107 (= G112), E110 (≠ G115), P129 (≠ T134), E130 (= E135), V135 (≠ F140), P137 (= P142), G138 (≠ A143), L223 (≠ Q232), F233 (vs. gap)
- binding calcium ion: F233 (vs. gap), Q238 (≠ F243)
Q8GYN9 1,4-dihydroxy-2-naphthoyl-CoA synthase, peroxisomal; DHNS; Enoyl-CoA hydratase/isomerase D; ECHID; Naphthoate synthase; EC 4.1.3.36 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
37% identity, 72% coverage: 5:190/258 of query aligns to 77:264/337 of Q8GYN9
Sites not aligning to the query:
- 20 H→V: Loss of peroxisomal targeting.
1mj3A Crystal structure analysis of rat enoyl-coa hydratase in complex with hexadienoyl-coa (see paper)
31% identity, 95% coverage: 13:258/258 of query aligns to 17:255/258 of 1mj3A
- active site: A68 (= A64), M73 (≠ L72), S83 (≠ A82), L85 (≠ S84), G109 (= G112), E112 (≠ G115), P131 (≠ T134), E132 (= E135), T137 (≠ F140), P139 (= P142), G140 (vs. gap), K225 (≠ Q232), F235 (vs. gap)
- binding hexanoyl-coenzyme a: K26 (≠ E22), A27 (≠ K23), L28 (≠ K24), A30 (= A26), A66 (= A62), G67 (= G63), A68 (= A64), D69 (= D65), I70 (≠ L66), G109 (= G112), P131 (≠ T134), E132 (= E135), L135 (≠ I138), G140 (vs. gap)
3q0gD Crystal structure of the mycobacterium tuberculosis crotonase bound to a reaction intermediate derived from crotonyl coa
29% identity, 97% coverage: 5:254/258 of query aligns to 5:245/250 of 3q0gD
- active site: A64 (= A64), M69 (≠ N80), T75 (≠ L87), F79 (= F91), G103 (= G112), E106 (≠ G115), P125 (≠ T134), E126 (= E135), V131 (≠ F140), P133 (= P142), G134 (≠ A143), L219 (≠ Q232), F229 (vs. gap)
- binding Butyryl Coenzyme A: F225 (≠ R238), F241 (= F250)
2dubA Enoyl-coa hydratase complexed with octanoyl-coa (see paper)
31% identity, 95% coverage: 13:258/258 of query aligns to 16:251/254 of 2dubA
- active site: A67 (= A64), M72 (≠ L72), S82 (≠ A82), G105 (= G112), E108 (≠ G115), P127 (≠ T134), E128 (= E135), T133 (≠ F140), P135 (= P142), G136 (vs. gap), K221 (≠ Q232), F231 (vs. gap)
- binding octanoyl-coenzyme a: K25 (≠ E22), A26 (≠ K23), L27 (≠ K24), A29 (= A26), A65 (= A62), A67 (= A64), D68 (= D65), I69 (≠ L66), K70 (≠ Q70), G105 (= G112), E108 (≠ G115), P127 (≠ T134), E128 (= E135), G136 (vs. gap), A137 (= A143)
3t3wF Crystal structure of probable enoyl-coa hydratase from mycobacterium thermoresistibile (see paper)
37% identity, 76% coverage: 2:196/258 of query aligns to 3:194/248 of 3t3wF
- active site: H65 (≠ A64), D71 (≠ Q70), S83 (≠ N85), L87 (≠ K89), G111 (= G112), L114 (≠ G115), V134 (≠ E135), I139 (= I138), G140 (= G139), E143 (≠ P142)
- binding zinc ion: E82 (≠ S84), E143 (≠ P142)
Sites not aligning to the query:
P14604 Enoyl-CoA hydratase, mitochondrial; mECH; mECH1; Enoyl-CoA hydratase 1; ECHS1; Short-chain enoyl-CoA hydratase; SCEH; EC 4.2.1.17; EC 5.3.3.8 from Rattus norvegicus (Rat) (see 3 papers)
31% identity, 95% coverage: 13:258/258 of query aligns to 47:287/290 of P14604
- E144 (≠ G115) mutation to D: Reduces activity 50-fold.; mutation to Q: Reduces activity 3300-fold.
- E164 (= E135) mutation to D: Reduces activity 1250-fold.; mutation to Q: Reduces activity 330000-fold.
Sites not aligning to the query:
- 1:29 modified: transit peptide, Mitochondrion
1dubA 2-enoyl-coa hydratase, data collected at 100 k, ph 6.5 (see paper)
31% identity, 95% coverage: 13:258/258 of query aligns to 17:257/260 of 1dubA
- active site: A68 (= A64), M73 (≠ L72), S83 (= S84), L87 (≠ K88), G111 (= G112), E114 (≠ G115), P133 (≠ T134), E134 (= E135), T139 (≠ F140), P141 (= P142), G142 (vs. gap), K227 (≠ Q232), F237 (vs. gap)
- binding acetoacetyl-coenzyme a: K26 (≠ E22), A27 (≠ K23), L28 (≠ K24), A30 (= A26), A66 (= A62), A68 (= A64), D69 (= D65), I70 (≠ L66), Y107 (≠ H108), G110 (≠ A111), G111 (= G112), E114 (≠ G115), P133 (≠ T134), E134 (= E135), L137 (≠ I138), G142 (vs. gap), F233 (≠ R238), F249 (= F250)
1ey3A Structure of enoyl-coa hydratase complexed with the substrate dac-coa (see paper)
31% identity, 95% coverage: 13:258/258 of query aligns to 15:255/258 of 1ey3A
- active site: A66 (= A64), M71 (≠ L72), S81 (= S84), L85 (≠ K88), G109 (= G112), E112 (≠ G115), P131 (≠ T134), E132 (= E135), T137 (≠ F140), P139 (= P142), G140 (vs. gap), K225 (≠ Q232), F235 (vs. gap)
- binding 4-(n,n-dimethylamino)cinnamoyl-coa: K24 (≠ E22), L26 (≠ K24), A28 (= A26), A64 (= A62), G65 (= G63), A66 (= A64), D67 (= D65), I68 (≠ L66), L85 (≠ K88), W88 (≠ F91), G109 (= G112), P131 (≠ T134), L135 (≠ I138), G140 (vs. gap)
2hw5C The crystal structure of human enoyl-coenzyme a (coa) hydratase short chain 1, echs1
30% identity, 98% coverage: 7:258/258 of query aligns to 5:257/260 of 2hw5C
- active site: A68 (= A64), M73 (≠ L69), S83 (≠ D83), L87 (= L87), G111 (= G112), E114 (≠ G115), P133 (≠ T134), E134 (= E135), T139 (≠ F140), P141 (= P142), G142 (vs. gap), K227 (≠ Q232), F237 (vs. gap)
- binding crotonyl coenzyme a: K26 (≠ E22), A27 (≠ K23), L28 (≠ K24), A30 (= A26), K62 (≠ D58), I70 (≠ L66), F109 (≠ I110)
4i52A Scmenb im complex with 1-hydroxy-2-naphthoyl-coa (see paper)
32% identity, 88% coverage: 5:230/258 of query aligns to 12:225/275 of 4i52A
- active site: G77 (≠ A64), R82 (≠ L69), Y87 (= Y74), R95 (≠ E78), L99 (≠ A82), G123 (= G112), V126 (≠ G115), G146 (≠ E135), S151 (vs. gap), D153 (≠ V141), G154 (≠ P142)
- binding 1-hydroxy-2-naphthoyl-CoA: H29 (≠ E22), K30 (= K23), R31 (≠ K24), A33 (= A26), S75 (≠ A62), G76 (= G63), G77 (≠ A64), D78 (= D65), Q79 (≠ L66), L96 (≠ E79), V98 (= V81), Y119 (≠ H108), I121 (= I110), G123 (= G112), T145 (= T134), V149 (≠ I138), S151 (vs. gap), F152 (= F140)
Sites not aligning to the query:
4i4zA Synechocystis sp. Pcc 6803 1,4-dihydroxy-2-naphthoyl-coenzyme a synthase (menb) in complex with salicylyl-coa (see paper)
32% identity, 88% coverage: 5:230/258 of query aligns to 12:225/275 of 4i4zA
- active site: G77 (≠ A64), R82 (≠ L69), Y87 (= Y74), R95 (≠ E78), L99 (≠ A82), G123 (= G112), V126 (≠ G115), G146 (≠ E135), S151 (vs. gap), D153 (≠ V141), G154 (≠ P142)
- binding Salicylyl CoA: H29 (≠ E22), K30 (= K23), R31 (≠ K24), S75 (≠ A62), G76 (= G63), G77 (≠ A64), D78 (= D65), Q79 (≠ L66), Y87 (= Y74), V98 (= V81), G123 (= G112), T145 (= T134), V149 (≠ I138), S151 (vs. gap)
- binding bicarbonate ion: G122 (≠ A111), Q144 (≠ Y133), T145 (= T134), G146 (≠ E135), W174 (≠ L162)
Sites not aligning to the query:
Q5HH38 1,4-dihydroxy-2-naphthoyl-CoA synthase; DHNA-CoA synthase; EC 4.1.3.36 from Staphylococcus aureus (strain COL) (see paper)
37% identity, 69% coverage: 5:182/258 of query aligns to 15:192/273 of Q5HH38
- R34 (≠ K24) binding in other chain
- SGGDQ 73:77 (≠ AGADL 62:66) binding in other chain
- S149 (vs. gap) binding in other chain
2uzfA Crystal structure of staphylococcus aureus 1,4-dihydroxy-2-naphthoyl coa synthase (menb) in complex with acetoacetyl coa (see paper)
37% identity, 69% coverage: 5:182/258 of query aligns to 10:179/260 of 2uzfA
- active site: G70 (≠ A64), R80 (≠ E78), L84 (≠ A82), G108 (= G112), V111 (≠ G115), T130 (= T134), G131 (≠ E135), S136 (vs. gap), D138 (≠ V141), A139 (≠ P142)
- binding acetoacetyl-coenzyme a: V28 (≠ K23), R29 (≠ K24), S68 (≠ A62), G69 (= G63), G70 (≠ A64), D71 (= D65), Y104 (≠ H108), G108 (= G112)
Sites not aligning to the query:
4emlA Synechocystis sp. Pcc 6803 1,4-dihydroxy-2-naphthoyl-coenzyme a synthase (menb) in complex with bicarbonate (see paper)
33% identity, 88% coverage: 5:230/258 of query aligns to 12:211/261 of 4emlA
- active site: G77 (≠ A64), R81 (≠ Y68), L85 (≠ A82), G109 (= G112), V112 (≠ G115), G132 (≠ E135), S137 (vs. gap), D139 (≠ V141), G140 (≠ P142)
- binding bicarbonate ion: G108 (≠ A111), Q130 (≠ Y133), G132 (≠ E135), W160 (≠ L162)
- binding chloride ion: D184 (≠ S186), R185 (≠ D187), E187 (≠ H189), E188 (≠ Q190)
Sites not aligning to the query:
6slaAAA Enoyl-CoA hydratase/carnithine racemase (see paper)
29% identity, 97% coverage: 4:253/258 of query aligns to 1:237/245 of 6slaAAA
- active site: Q61 (≠ A64), L68 (≠ Q71), N72 (= N75), A96 (≠ G112), S99 (≠ G115), A118 (≠ T134), F119 (≠ E135), L124 (≠ F140), P126 (= P142), N127 (vs. gap), A212 (≠ E228), G222 (≠ R238)
- binding ~{S}-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethyl] 2-(2,5-dihydrooxepin-7-yl)ethanethioate: L21 (≠ K24), A59 (= A62), Q61 (≠ A64), D62 (= D65), L63 (= L66), L68 (≠ Q71), Y71 (= Y74), A94 (≠ I110), G95 (≠ A111), A96 (≠ G112), F119 (≠ E135), I122 (= I138), L124 (≠ F140), N127 (vs. gap), F234 (= F250), K237 (= K253)
Query Sequence
>CA265_RS09125 FitnessBrowser__Pedo557:CA265_RS09125
MENLVLYQVAERIATITINRPEKKNALNPQLIAELTAAFIKASEDDLVKVVILNANGDAF
SAGADLAYLQQLQYNTFEENVADSNHLKKLFTTIYYLPKVVIAQVEGHAIAGGCGLATIC
DIVFATPESNFGYTEVKIGFVPAIVSCFLKEKVSESIAKEILLTGKIFSAEEALKYNLIN
FVTNSSDIHQIVREFALSLCSGSSGNSLMITKQLITQTTNPLLEKCLETAVQINARVRES
EDFKKGISSFLNKEKINW
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory