Comparing CA265_RS09295 FitnessBrowser__Pedo557:CA265_RS09295 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
P70712 Kynureninase; L-kynurenine hydrolase; EC 3.7.1.3 from Rattus norvegicus (Rat) (see paper)
45% identity, 93% coverage: 14:414/429 of query aligns to 34:448/464 of P70712
Sites not aligning to the query:
3e9kA Crystal structure of homo sapiens kynureninase-3-hydroxyhippuric acid inhibitor complex (see paper)
46% identity, 93% coverage: 14:414/429 of query aligns to 29:434/446 of 3e9kA
2hzpA Crystal structure of homo sapiens kynureninase (see paper)
46% identity, 93% coverage: 14:414/429 of query aligns to 29:435/447 of 2hzpA
Q16719 Kynureninase; L-kynurenine hydrolase; EC 3.7.1.3 from Homo sapiens (Human) (see 4 papers)
46% identity, 93% coverage: 14:414/429 of query aligns to 34:448/465 of Q16719
Sites not aligning to the query:
1qz9A The three dimensional structure of kynureninase from pseudomonas fluorescens (see paper)
29% identity, 95% coverage: 14:420/429 of query aligns to 10:394/404 of 1qz9A
P83788 Kynureninase; L-kynurenine hydrolase; EC 3.7.1.3 from Pseudomonas fluorescens (see paper)
29% identity, 98% coverage: 1:420/429 of query aligns to 1:395/416 of P83788
>CA265_RS09295 FitnessBrowser__Pedo557:CA265_RS09295
MNFENNLLFAQTQDETDQLRDFRSQFLFPNHNGKDLIYLCGNSLGLQPKVAGEVLKNQLN
NWANYAVEGWFDGNEPWIFYHKALKKLMAPIVGALPSEVCPMNTLTVNLHLLMVSFYQPK
GKRFKIIMEGGAFPSDQYAIESQVRFHGFDPKEAIIEVFPKEGEEILHTADIIAQIKENA
DEIALVLFGGINYYTGQWYDMETITKAGHEIGAIVGWDLAHAAGNVPVKLHDWDVDFACW
CSYKYQNSGPGGISGIFVHEKHFNNTGLNRFAGWWGYQEHKRFKMEKGFIPETGADGWQV
SCTQVMPMALYHASLQIFEQAGFIEPLRNKSITLTAYLEYIINEINKELGVLQYKIITPK
VAKDRGAQLSIIAERNGKQIFDGLMANHVLGDWREPDVIRLSAVPLYNSFEDVYLAGQAL
LKVSKEVLR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory