SitesBLAST
Comparing CA265_RS09515 FitnessBrowser__Pedo557:CA265_RS09515 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q48255 3-dehydroquinate dehydratase; 3-dehydroquinase; Type II DHQase; EC 4.2.1.10 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
48% identity, 99% coverage: 2:138/139 of query aligns to 1:142/167 of Q48255
- N76 (= N72) binding
- H82 (= H78) binding
- D89 (= D85) binding
- R113 (= R109) binding
2xd9A Structure of helicobacter pylori type ii dehydroquinase in complex with inhibitor compound (4r,6r,7s)-4,6,7-trihydroxy-2-((e)-prop-1- enyl)-4,5,6,7-tetrahydrobenzo(b)thiophene-4-carboxylic acid (see paper)
48% identity, 99% coverage: 2:138/139 of query aligns to 1:142/153 of 2xd9A
- active site: P9 (= P10), N10 (= N11), R17 (= R18), Y22 (= Y23), N76 (= N72), A79 (≠ G75), E100 (= E96), H102 (= H98), R109 (= R105)
- binding (4r,6r,7s)-4,6,7-trihydroxy-2-[(1e)-prop-1-en-1-yl]-4,5,6,7-tetrahydro-1-benzothiophene-4-carboxylic acid: N10 (= N11), L14 (= L15), Y22 (= Y23), N76 (= N72), G78 (= G74), A79 (≠ G75), H82 (= H78), H102 (= H98), L103 (≠ I99), T104 (≠ S100), R113 (= R109)
2wksA Structure of helicobacter pylori type ii dehydroquinase with a new carbasugar-thiophene inhibitor. (see paper)
48% identity, 99% coverage: 2:138/139 of query aligns to 1:142/153 of 2wksA
- active site: P9 (= P10), N10 (= N11), R17 (= R18), Y22 (= Y23), N76 (= N72), A79 (≠ G75), E100 (= E96), H102 (= H98), R109 (= R105)
- binding (1R,4S,5R)-1,4,5-trihydroxy-3-[(5-methyl-1-benzothiophen-2-yl)methoxy]cyclohex-2-ene-1-carboxylic acid: L11 (= L12), Y22 (= Y23), N76 (= N72), G78 (= G74), A79 (≠ G75), H82 (= H78), H102 (= H98), L103 (≠ I99), T104 (≠ S100), R113 (= R109)
4b6sA Structure of helicobacter pylori type ii dehydroquinase inhibited by (2s)-2-perfluorobenzyl-3-dehydroquinic acid (see paper)
48% identity, 99% coverage: 2:138/139 of query aligns to 1:142/158 of 4b6sA
- active site: P9 (= P10), N10 (= N11), R17 (= R18), Y22 (= Y23), N76 (= N72), A79 (≠ G75), E100 (= E96), H102 (= H98), R109 (= R105)
- binding (1R,2S,4S,5R)-2-(2,3,4,5,6-pentafluorophenyl)methyl-1,4,5-trihydroxy-3-oxocyclohexane-1-carboxylic acid: N10 (= N11), L14 (= L15), Y22 (= Y23), N76 (= N72), G78 (= G74), A79 (≠ G75), H82 (= H78), H102 (= H98), L103 (≠ I99), T104 (≠ S100), R113 (= R109)
2xb9A Structure of helicobacter pylori type ii dehydroquinase in complex with inhibitor compound (2r)-2-(4-methoxybenzyl)-3-dehydroquinic acid (see paper)
48% identity, 99% coverage: 2:138/139 of query aligns to 1:142/158 of 2xb9A
- active site: P9 (= P10), N10 (= N11), R17 (= R18), Y22 (= Y23), N76 (= N72), A79 (≠ G75), E100 (= E96), H102 (= H98), R109 (= R105)
- binding (1r,2r,4s,5r)-1,4,5-trihydroxy-2-(4-methoxybenzyl)-3-oxocyclohexanecarboxylic acid: N10 (= N11), Y22 (= Y23), N76 (= N72), A79 (≠ G75), H82 (= H78), H102 (= H98), L103 (≠ I99), T104 (≠ S100), R113 (= R109)
1j2yA Crystal structure of the type ii 3-dehydroquinase (see paper)
48% identity, 99% coverage: 2:138/139 of query aligns to 1:142/158 of 1j2yA
- active site: P9 (= P10), N10 (= N11), R17 (= R18), Y22 (= Y23), N76 (= N72), A79 (≠ G75), E100 (= E96), H102 (= H98), R109 (= R105)
- binding 1,3,4-trihydroxy-5-oxo-cyclohexanecarboxylic acid: Y22 (= Y23), N76 (= N72), G78 (= G74), H82 (= H78), H102 (= H98), L103 (≠ I99), T104 (≠ S100), R113 (= R109)
2xdaA Structure of helicobacter pylori type ii dehydroquinase in complex with inhibitor compound (4r,6r,7s)-2-(2-cyclopropyl)ethyl-4,6,7- trihydroxy-4,5,6,7-tetrahydrobenzo(b)thiophene-4-carboxylic acid (see paper)
48% identity, 99% coverage: 2:138/139 of query aligns to 1:142/150 of 2xdaA
- active site: P9 (= P10), N10 (= N11), R17 (= R18), Y22 (= Y23), N76 (= N72), A79 (≠ G75), E100 (= E96), H102 (= H98), R109 (= R105)
- binding (4r,6r,7s)-2-(2-cyclopropylethyl)-4,6,7-trihydroxy-4,5,6,7-tetrahydro-1-benzothiophene-4-carboxylic acid: N10 (= N11), L11 (= L12), M13 (≠ L14), Y22 (= Y23), N76 (= N72), A79 (≠ G75), H82 (= H78), H102 (= H98), L103 (≠ I99), T104 (≠ S100), R113 (= R109)
4b6rA Structure of helicobacter pylori type ii dehydroquinase inhibited by (2s)-2-(4-methoxy)benzyl-3-dehydroquinic acid (see paper)
48% identity, 99% coverage: 2:138/139 of query aligns to 1:142/157 of 4b6rA
- active site: P9 (= P10), N10 (= N11), R17 (= R18), Y22 (= Y23), N76 (= N72), A79 (≠ G75), E100 (= E96), H102 (= H98), R109 (= R105)
- binding (1R,2S,4S,5R)-2-(4-methoxyphenyl)methyl-1,4,5-trihydroxy-3-oxocyclohexane-1-carboxylic acid: Y22 (= Y23), N76 (= N72), G78 (= G74), A79 (≠ G75), H82 (= H78), D89 (= D85), L93 (≠ A89), H102 (= H98), L103 (≠ I99), T104 (≠ S100), R113 (= R109)
2c4wA Type ii dehydroquinase from h. Pylori in complex with ah9095 (see paper)
48% identity, 99% coverage: 2:138/139 of query aligns to 10:151/168 of 2c4wA
- active site: P18 (= P10), N19 (= N11), R26 (= R18), Y31 (= Y23), N85 (= N72), A88 (≠ G75), E109 (= E96), H111 (= H98), R118 (= R105)
- binding n-tetrazol-5-yl 9-oxo-9h-xanthene-2 sulphonamide: L20 (= L12), L23 (= L15), D27 (≠ E19), G87 (= G74), H91 (= H78), H111 (= H98), L112 (≠ I99), T113 (≠ S100), I115 (= I102), R122 (= R109)
8idrC Crystal structure of apo-form of dehydroquinate dehydratase from corynebacterium glutamicum (see paper)
48% identity, 97% coverage: 3:137/139 of query aligns to 3:139/147 of 8idrC
6hsaA The crystal structure of type ii dehydroquinase from butyrivibrio crossotus dsm 2876
51% identity, 98% coverage: 2:137/139 of query aligns to 4:143/145 of 6hsaA
6hs9A The crystal structure of type ii dehydroquinase from butyrivibrio crossotus dsm 2876
51% identity, 98% coverage: 2:137/139 of query aligns to 4:143/145 of 6hs9A
- active site: P12 (= P10), N13 (= N11), R20 (= R18), Y25 (= Y23), N77 (= N72), A80 (≠ G75), E102 (= E96), H104 (= H98), R111 (= R105)
- binding (4S,5R)-4,5-dihydroxy-3-oxocyclohex-1-ene-1-carboxylic acid: R20 (= R18), Y25 (= Y23), G79 (= G74), A80 (≠ G75), H83 (= H78), I105 (= I99), S106 (= S100), R115 (= R109)
2c57A H.Pylori type ii dehydroquinase in complex with fa1 (see paper)
46% identity, 99% coverage: 2:138/139 of query aligns to 14:148/164 of 2c57A
- active site: P22 (= P10), N23 (= N11), N82 (= N72), A85 (≠ G75), E106 (= E96), H108 (= H98), R115 (= R105)
- binding 2,3 -anhydro-quinic acid: N82 (= N72), G84 (= G74), A85 (≠ G75), H88 (= H78), H108 (= H98), L109 (≠ I99), T110 (≠ S100), R119 (= R109)
8iduA Crystal structure of substrate bound-form dehydroquinate dehydratase from corynebacterium glutamicum (see paper)
47% identity, 97% coverage: 3:137/139 of query aligns to 3:139/145 of 8iduA
- binding 1,3,4-trihydroxy-5-oxo-cyclohexanecarboxylic acid: Y23 (= Y23), N74 (= N72), G76 (= G74), G77 (= G75), H80 (= H78), H100 (= H98), I101 (= I99), S102 (= S100), R111 (= R109)
P15474 3-dehydroquinate dehydratase; 3-dehydroquinase; Type II DHQase; EC 4.2.1.10 from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) (see 2 papers)
43% identity, 96% coverage: 4:137/139 of query aligns to 10:146/157 of P15474
- R24 (= R18) mutation to A: Reduces kcat 30000-fold. Reduces KM for 3-dehydroquinate 6-fold.; mutation to K: Reduces kcat 2700-fold. Reduces KM for 3-dehydroquinate 4-fold.; mutation to Q: Reduces kcat 3100-fold. Reduces KM for 3-dehydroquinate 8-fold.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
2cjfA Type ii dehydroquinase inhibitor complex (see paper)
43% identity, 96% coverage: 4:137/139 of query aligns to 8:144/149 of 2cjfA
- binding (1s,4s,5s)-1,4,5-trihydroxy-3-[3-(phenylthio)phenyl]cyclohex-2-ene-1-carboxylic acid: N15 (= N11), L16 (= L12), L18 (= L14), L19 (= L15), R22 (= R18), Y27 (= Y23), N78 (= N72), A80 (≠ G74), A81 (≠ G75), H84 (= H78), H105 (= H98), I106 (= I99), S107 (= S100), R116 (= R109)
2bt4A Type ii dehydroquinase inhibitor complex (see paper)
43% identity, 96% coverage: 4:137/139 of query aligns to 8:144/149 of 2bt4A
- binding (1s,3r,4r,5s)-1,3,4-trihydroxy-5-(3-phenoxypropyl)cyclohexanecarboxylic acid: N15 (= N11), L18 (= L14), R22 (= R18), Y27 (= Y23), N78 (= N72), A80 (≠ G74), A81 (≠ G75), H84 (= H78), H105 (= H98), I106 (= I99), S107 (= S100), R116 (= R109)
1gu1A Crystal structure of type ii dehydroquinase from streptomyces coelicolor complexed with 2,3-anhydro-quinic acid (see paper)
43% identity, 96% coverage: 4:137/139 of query aligns to 8:144/149 of 1gu1A
- active site: P14 (= P10), N15 (= N11), R22 (= R18), Y27 (= Y23), N78 (= N72), A81 (≠ G75), E103 (= E96), H105 (= H98), R112 (= R105)
- binding 2,3 -anhydro-quinic acid: Y27 (= Y23), N78 (= N72), A80 (≠ G74), A81 (≠ G75), H84 (= H78), H105 (= H98), I106 (= I99), S107 (= S100), R116 (= R109)
- binding glycerol: N15 (= N11), L16 (= L12), L19 (= L15), Y27 (= Y23)
1v1jA Crystal structure of type ii dehydroquintae dehydratase from streptomyces coelicolor in complex with 3-fluoro (see paper)
43% identity, 96% coverage: 4:137/139 of query aligns to 9:145/150 of 1v1jA
- active site: P15 (= P10), N16 (= N11), R23 (= R18), Y28 (= Y23), N79 (= N72), A82 (≠ G75), E104 (= E96), H106 (= H98), R113 (= R105)
- binding 2-anhydro-3-fluoro-quinic acid: Y28 (= Y23), N79 (= N72), A81 (≠ G74), A82 (≠ G75), H85 (= H78), H106 (= H98), I107 (= I99), S108 (= S100), R117 (= R109)
4b6pA Structure of mycobacterium tuberculosis type ii dehydroquinase inhibited by (2s)-2-perfluorobenzyl-3-dehydroquinic acid (see paper)
40% identity, 96% coverage: 4:137/139 of query aligns to 3:138/142 of 4b6pA
- active site: P9 (= P10), N10 (= N11), R17 (= R18), Y22 (= Y23), N73 (= N72), G76 (= G75), E97 (= E96), H99 (= H98), R106 (= R105)
- binding (1R,2S,4S,5R)-2-(2,3,4,5,6-pentafluorophenyl)methyl-1,4,5-trihydroxy-3-oxocyclohexane-1-carboxylic acid: N10 (= N11), L14 (= L15), R17 (= R18), Y22 (= Y23), N73 (= N72), G75 (= G74), G76 (= G75), H79 (= H78), H99 (= H98), I100 (= I99), S101 (= S100), R110 (= R109)
Query Sequence
>CA265_RS09515 FitnessBrowser__Pedo557:CA265_RS09515
MMKIQIINGPNLNLLGVREPSIYGNTSIEDYIKELKTVYPDIEIEYYQSNVEGEIINKLH
EVGFSYDGVVLNAGGYTHTSVAIADAIAAIKTPVVEVHISNIYAREEYRHVSLTGKNCQG
VLTGFGMKGYRLAIESLLI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory