Comparing CA265_RS09650 CA265_RS09650 diaminopimelate decarboxylase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
B4XMC6 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Helicobacter pylori (Campylobacter pylori) (see paper)
41% identity, 95% coverage: 10:379/390 of query aligns to 8:369/405 of B4XMC6
3c5qA Crystal structure of diaminopimelate decarboxylase (i148l mutant) from helicobacter pylori complexed with l-lysine
41% identity, 95% coverage: 10:379/390 of query aligns to 6:362/394 of 3c5qA
4xg1B Psychromonas ingrahamii diaminopimelate decarboxylase with llp
40% identity, 94% coverage: 15:379/390 of query aligns to 27:384/418 of 4xg1B
6n2aA Meso-diaminopimelate decarboxylase from arabidopsis thaliana (isoform 1)
37% identity, 93% coverage: 16:379/390 of query aligns to 31:389/422 of 6n2aA
Q58497 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
39% identity, 90% coverage: 40:389/390 of query aligns to 65:412/438 of Q58497
1tufA Crystal structure of diaminopimelate decarboxylase from m. Jannaschi (see paper)
39% identity, 90% coverage: 40:389/390 of query aligns to 61:408/434 of 1tufA
1twiA Crystal structure of diaminopimelate decarboxylase from m. Jannaschii in co-complex with l-lysine (see paper)
39% identity, 90% coverage: 40:389/390 of query aligns to 61:408/434 of 1twiA
Q9X1K5 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8)
37% identity, 93% coverage: 15:377/390 of query aligns to 13:352/386 of Q9X1K5
4xg1A Psychromonas ingrahamii diaminopimelate decarboxylase with llp
38% identity, 94% coverage: 15:379/390 of query aligns to 25:359/393 of 4xg1A
2yxxA Crystal structure analysis of diaminopimelate decarboxylate (lysa)
37% identity, 93% coverage: 15:377/390 of query aligns to 12:351/385 of 2yxxA
7ru7A Crystal structure of btrk, a decarboxylase involved in butirosin biosynthesis
33% identity, 91% coverage: 14:369/390 of query aligns to 16:370/412 of 7ru7A
1ko0A Crystal structure of a d,l-lysine complex of diaminopimelate decarboxylase
32% identity, 95% coverage: 16:385/390 of query aligns to 26:394/419 of 1ko0A
P00861 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Escherichia coli (strain K12)
32% identity, 95% coverage: 16:385/390 of query aligns to 27:395/420 of P00861
1knwA Crystal structure of diaminopimelate decarboxylase
32% identity, 95% coverage: 16:385/390 of query aligns to 26:394/421 of 1knwA
P9WIU7 Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
30% identity, 96% coverage: 15:387/390 of query aligns to 40:426/447 of P9WIU7
1hkvA Mycobacterium diaminopimelate dicarboxylase (lysa) (see paper)
30% identity, 96% coverage: 15:387/390 of query aligns to 39:425/446 of 1hkvA
5x7mA Crystal structure of meso-diaminopimelate decarboxylase (dapdc) from corynebacterium glutamicum (see paper)
31% identity, 95% coverage: 15:385/390 of query aligns to 41:421/443 of 5x7mA
5x7nA Crystal structure of meso-diaminopimelate decarboxylase (dapdc) from corynebacterium glutamicum (see paper)
31% identity, 95% coverage: 15:385/390 of query aligns to 41:421/442 of 5x7nA
6kniA Crystal structure of sbnh in complex with the cofactor plp, a plp- dependent decarboxylase in staphyloferrin b biothesynthesis (see paper)
28% identity, 90% coverage: 18:369/390 of query aligns to 20:360/381 of 6kniA
6knhC Crystal structure of sbnh in complex with citrate, a plp-dependent decarboxylase in staphyloferrin b biothesynthesis (see paper)
27% identity, 90% coverage: 18:369/390 of query aligns to 20:364/384 of 6knhC
>CA265_RS09650 CA265_RS09650 diaminopimelate decarboxylase
MFADKDISKFNNIETPFYYYDTDLLQKTLRTCADAAAPYQFHIHYALKANFNSVLLNQIK
EIGFGADCVSAGEVRRAVEVGFDHKKIVFAGVGKSDKEINEALDLDIFCFNVESIQELEV
LNELAGKKGKTAQVAIRINPNVDAHTHHNITTGLDENKFGINSWDLPECADTLKASPNLK
FIGIHFHIGSQITNLDVYKNLCVRVNEFAAWFEDKGFNLQVLNVGGGLGIDYHNPDHQIP
DFKSYFKIFSEFLTVKPGQEVHFELGRALVGQSASLITRVLYIKNGKKKNFVVLDAGMTE
LMRPALYQAYHKIENLSRKSEVGSPESTALKYDIVGPICESTDCFGKEVEQPESFRGDIF
AIRSAGAYGEVMASKYNLRDAIRSVYSSEI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory