Comparing CA265_RS09805 FitnessBrowser__Pedo557:CA265_RS09805 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2w90B Geobacillus stearothermophilus 6-phosphogluconate dehydrogenase with bound 6- phosphogluconate (see paper)
47% identity, 98% coverage: 8:469/471 of query aligns to 5:471/471 of 2w90B
P96789 6-phosphogluconate dehydrogenase, decarboxylating; EC 1.1.1.44 from Lactococcus lactis subsp. cremoris (strain MG1363) (see paper)
46% identity, 97% coverage: 11:467/471 of query aligns to 6:468/472 of P96789
2iypA Product rup (see paper)
46% identity, 97% coverage: 11:467/471 of query aligns to 6:468/469 of 2iypA
2iypB Product rup (see paper)
46% identity, 97% coverage: 11:467/471 of query aligns to 7:469/470 of 2iypB
2iyoA Structural characterization of a bacterial 6pdh reveals aspects of specificity, mechanism and mode of inhibition (see paper)
46% identity, 97% coverage: 11:467/471 of query aligns to 6:468/470 of 2iyoA
2iz1B 6pdh complexed with pex inhibitor synchrotron data (see paper)
46% identity, 97% coverage: 11:467/471 of query aligns to 8:470/471 of 2iz1B
6fqzA Plasmodium falciparum 6-phosphogluconate dehydrogenase in its apo form, in complex with its cofactor NADP+ and in complex with its substrate 6-phosphogluconate (see paper)
46% identity, 97% coverage: 11:467/471 of query aligns to 4:468/468 of 6fqzA
6fqyA Plasmodium falciparum 6-phosphogluconate dehydrogenase in its apo form, in complex with its cofactor NADP+ and in complex with its substrate 6-phosphogluconate (see paper)
46% identity, 97% coverage: 11:467/471 of query aligns to 4:468/468 of 6fqyA
7cb5B The 6-phosphogluconate dehydrogenase from staphylococcus aureus (6- phosphogluconate bound) (see paper)
45% identity, 97% coverage: 10:467/471 of query aligns to 4:465/467 of 7cb5B
7cb2A The 6-phosphogluconate dehydrogenase (NADP-bound) from staphylococcus aureus
45% identity, 97% coverage: 10:467/471 of query aligns to 4:465/466 of 7cb2A
P00350 6-phosphogluconate dehydrogenase, decarboxylating; EC 1.1.1.44 from Escherichia coli (strain K12) (see paper)
45% identity, 98% coverage: 8:467/471 of query aligns to 3:466/468 of P00350
3fwnB Dimeric 6-phosphogluconate dehydrogenase complexed with 6- phosphogluconate and 2'-monophosphoadenosine-5'-diphosphate (see paper)
45% identity, 98% coverage: 8:467/471 of query aligns to 2:465/467 of 3fwnB
3fwnA Dimeric 6-phosphogluconate dehydrogenase complexed with 6- phosphogluconate and 2'-monophosphoadenosine-5'-diphosphate (see paper)
45% identity, 98% coverage: 8:467/471 of query aligns to 2:465/467 of 3fwnA
2zydA Dimeric 6-phosphogluconate dehydrogenase complexed with glucose (see paper)
44% identity, 98% coverage: 8:467/471 of query aligns to 1:464/464 of 2zydA
8i4qA Crystal structure of 6-phosphogluconate dehydrogenase from corynebacterium glutamicum (see paper)
44% identity, 97% coverage: 10:468/471 of query aligns to 4:471/479 of 8i4qA
P78812 6-phosphogluconate dehydrogenase, decarboxylating; EC 1.1.1.44 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
45% identity, 97% coverage: 11:468/471 of query aligns to 9:479/492 of P78812
2p4qA Crystal structure analysis of gnd1 in saccharomyces cerevisiae (see paper)
45% identity, 97% coverage: 11:467/471 of query aligns to 5:475/476 of 2p4qA
1pgqA Crystallographic study of coenzyme, coenzyme analogue and substrate binding in 6-phosphogluconate dehydrogenase: implications for NADP specificity and the enzyme mechanism (see paper)
45% identity, 97% coverage: 11:468/471 of query aligns to 5:469/473 of 1pgqA
1pgpA Crystallographic study of coenzyme, coenzyme analogue and substrate binding in 6-phosphogluconate dehydrogenase: implications for NADP specificity and the enzyme mechanism (see paper)
45% identity, 97% coverage: 11:468/471 of query aligns to 5:469/473 of 1pgpA
1pgoA Crystallographic study of coenzyme, coenzyme analogue and substrate binding in 6-phosphogluconate dehydrogenase: implications for NADP specificity and the enzyme mechanism (see paper)
45% identity, 97% coverage: 11:468/471 of query aligns to 5:469/473 of 1pgoA
>CA265_RS09805 FitnessBrowser__Pedo557:CA265_RS09805
MANNDSKKYKLGMIGLGTMGRNLLLNMADKGFSVTGYDKDRKMISKLEEEGKKHNLEGFD
DIESFISSLQTSRTLILLVPAGPIVDSVIAELKPLLSKGDIIIDSGNSHFTDTNRRVDEL
EKDGLHFFGMGISGGEEGARFGPSMMPGGDKQAYNVVKDVFDAVAAKVGTDPCVTYIGPG
ASGHFVKMVHNGIEYAIMELIAEVYGILKNGLGYSNNEIYQVFKKWNEGRLQSFLLEITA
EIFLFKDTETQNDLLDQIKDEARSKGTGKWTSEVSMELQLPVPTINEAVSNRDLSKFKKL
RVSLEEAFGKKDTKIAVTVDELEDAFYFSMISAYAQGMHLLVQASKEYQYDLQLQEIAKI
WRGGCIIRAKFLEDIYQAYDKNNALEHLFGDAGIQNIIKGTLPGTRKTISACINSGLGIP
AFASTLTYFDTITTARMPSNLIQAQRDFFGAHTFERIDKDGVFHADWNKLS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory