SitesBLAST
Comparing CA265_RS09910 FitnessBrowser__Pedo557:CA265_RS09910 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
34% identity, 73% coverage: 1:203/280 of query aligns to 1:212/246 of 3osuA
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
35% identity, 71% coverage: 5:203/280 of query aligns to 2:205/239 of 3sj7A
- active site: G12 (= G15), S138 (= S137), Q148 (≠ W147), Y151 (= Y150), K155 (= K154)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G11), S10 (= S13), R11 (≠ K14), I13 (≠ L16), N31 (≠ T34), Y32 (≠ S35), A33 (≠ R36), G34 (≠ N37), S35 (≠ I38), A58 (≠ V57), N59 (= N58), V60 (≠ L59), N86 (= N85), A87 (= A86), T109 (≠ V108), S138 (= S137), Y151 (= Y150), K155 (= K154), P181 (= P180), G182 (= G181)
P73574 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-acyl carrier protein reductase; EC 1.1.1.100 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
32% identity, 84% coverage: 5:238/280 of query aligns to 7:228/247 of P73574
- A14 (= A12) mutation to G: 4.2-fold increase in activity on acetoacetyl-CoA.
- P151 (≠ T145) mutation to F: 2.7-fold increase in activity on acetoacetyl-CoA.; mutation to V: 5.7-fold increase in activity on acetoacetyl-CoA.
- K160 (= K154) mutation to A: Almost no activity on acetoacetyl-CoA.
- F188 (= F183) mutation to Y: 3.3-fold increase in activity on acetoacetyl-CoA.
- N198 (≠ A196) mutation to R: 3.5-fold increase in activity on acetoacetyl-CoA.
4nbuB Crystal structure of fabg from bacillus sp (see paper)
30% identity, 84% coverage: 3:236/280 of query aligns to 6:225/244 of 4nbuB
- active site: G18 (= G15), N111 (= N109), S139 (= S137), Q149 (≠ W147), Y152 (= Y150), K156 (= K154)
- binding acetoacetyl-coenzyme a: D93 (≠ G91), K98 (≠ E96), S139 (= S137), N146 (≠ A144), V147 (≠ T145), Q149 (≠ W147), Y152 (= Y150), F184 (≠ A182), M189 (≠ I194), K200 (≠ E205)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G11), N17 (≠ K14), G18 (= G15), I19 (≠ L16), D38 (≠ S35), F39 (≠ R36), V59 (= V57), D60 (≠ N58), V61 (≠ L59), N87 (= N85), A88 (= A86), G89 (= G87), I90 (≠ Y88), T137 (≠ I135), S139 (= S137), Y152 (= Y150), K156 (= K154), P182 (= P180), F184 (≠ A182), T185 (≠ F183), T187 (= T185), M189 (≠ I194)
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
33% identity, 67% coverage: 3:190/280 of query aligns to 5:197/252 of 1vl8B
- active site: G17 (= G15), S143 (= S137), I154 (≠ W147), Y157 (= Y150), K161 (= K154)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G11), R16 (≠ K14), G17 (= G15), L18 (= L16), S37 (= S35), R38 (= R36), C63 (≠ V57), D64 (≠ N58), V65 (≠ L59), A91 (≠ N85), A92 (= A86), G93 (= G87), I94 (≠ Y88), V114 (= V108), I141 (= I135), S143 (= S137), Y157 (= Y150), K161 (= K154), P187 (= P180), G188 (= G181), Y190 (≠ F183), T192 (= T185), M194 (≠ F187), T195 (≠ L188)
6zzsD Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and 3-oxovalerate (see paper)
33% identity, 66% coverage: 5:188/280 of query aligns to 8:194/261 of 6zzsD
- active site: G18 (= G15), S143 (= S137), Y156 (= Y150)
- binding nicotinamide-adenine-dinucleotide: G14 (= G11), S17 (≠ K14), I19 (≠ L16), D38 (≠ S35), M39 (≠ R36), D64 (≠ N58), V65 (≠ L59), N91 (= N85), A92 (= A86), G93 (= G87), M141 (≠ I135), A142 (= A136), S143 (= S137), Y156 (= Y150), K160 (= K154), P186 (= P180), G187 (= G181), V189 (≠ F183), T191 (= T185), L193 (≠ F187)
- binding 3-oxidanylidenepentanoic acid: Q95 (≠ G89), S143 (= S137), N145 (≠ A139), K153 (≠ W147), Y156 (= Y150)
Sites not aligning to the query:
6zzqA Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and acetoacetate (see paper)
33% identity, 66% coverage: 5:188/280 of query aligns to 7:193/260 of 6zzqA
- active site: G17 (= G15), S142 (= S137), Y155 (= Y150)
- binding acetoacetic acid: Q94 (≠ G89), S142 (= S137), K152 (≠ W147), Y155 (= Y150)
- binding nicotinamide-adenine-dinucleotide: G13 (= G11), S16 (≠ K14), G17 (= G15), I18 (≠ L16), D37 (≠ S35), M38 (≠ R36), D63 (≠ N58), V64 (≠ L59), N90 (= N85), A91 (= A86), G92 (= G87), M140 (≠ I135), A141 (= A136), S142 (= S137), Y155 (= Y150), K159 (= K154), Y187 (≠ A182), V188 (≠ F183), T190 (= T185)
Sites not aligning to the query:
1zemA Crystal structure of NAD+-bound xylitol dehydrogenase (see paper)
27% identity, 88% coverage: 5:250/280 of query aligns to 6:247/260 of 1zemA
- active site: N16 (≠ G15), S142 (= S137), Y155 (= Y150), K159 (= K154), D212 (= D217)
- binding nicotinamide-adenine-dinucleotide: G12 (= G11), G15 (≠ K14), N16 (≠ G15), I17 (≠ L16), D36 (≠ S35), M37 (≠ R36), D62 (≠ N58), V63 (≠ L59), N89 (= N85), A90 (= A86), G91 (= G87), T140 (≠ I135), S142 (= S137), Y155 (= Y150), K159 (= K154), P185 (= P180), M188 (≠ F183)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
32% identity, 75% coverage: 5:214/280 of query aligns to 6:224/247 of 4jroC
- active site: G16 (= G15), S142 (= S137), Q152 (≠ W147), Y155 (= Y150), K159 (= K154)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G11), S14 (= S13), R15 (≠ K14), G16 (= G15), I17 (≠ L16), N35 (vs. gap), Y36 (vs. gap), N37 (≠ A32), G38 (≠ A33), S39 (≠ T34), N63 (= N58), V64 (≠ L59), N90 (= N85), A91 (= A86), I93 (≠ Y88), I113 (≠ V108), S142 (= S137), Y155 (= Y150), K159 (= K154), P185 (= P180), I188 (≠ R184), T190 (≠ S186)
1e3wD Rat brain 3-hydroxyacyl-coa dehydrogenase binary complex with nadh and 3-keto butyrate (see paper)
34% identity, 67% coverage: 3:189/280 of query aligns to 3:201/255 of 1e3wD
- active site: G15 (= G15), N115 (= N109), T147 (≠ I135), S149 (= S137), Y162 (= Y150), K166 (= K154), F195 (= F183)
- binding acetoacetic acid: Y162 (= Y150)
- binding nicotinamide-adenine-dinucleotide: G11 (= G11), S14 (≠ K14), G15 (= G15), L16 (= L16), D35 (≠ S35), V36 (≠ R36), N58 (= N58), V59 (≠ L59), C85 (≠ N85), A86 (= A86), G87 (= G87), V114 (= V108), T147 (≠ I135), Y162 (= Y150), K166 (= K154), P192 (= P180), L194 (≠ A182), F195 (= F183), T197 (= T185), L199 (≠ F187)
Sites not aligning to the query:
O70351 3-hydroxyacyl-CoA dehydrogenase type-2; 17-beta-estradiol 17-dehydrogenase; 2-methyl-3-hydroxybutyryl-CoA dehydrogenase; MHBD; 3-alpha-(17-beta)-hydroxysteroid dehydrogenase (NAD(+)); 3-hydroxy-2-methylbutyryl-CoA dehydrogenase; 3-hydroxyacyl-CoA dehydrogenase type II; 3alpha(or 20beta)-hydroxysteroid dehydrogenase; 7-alpha-hydroxysteroid dehydrogenase; Endoplasmic reticulum-associated amyloid beta-peptide-binding protein; Mitochondrial ribonuclease P protein 2; Mitochondrial RNase P protein 2; Short chain dehydrogenase/reductase family 5C member 1; Short-chain type dehydrogenase/reductase XH98G2; Type II HADH; EC 1.1.1.35; EC 1.1.1.62; EC 1.1.1.239; EC 1.1.1.178; EC 1.1.1.53; EC 1.1.1.159 from Rattus norvegicus (Rat) (see paper)
34% identity, 67% coverage: 3:189/280 of query aligns to 9:207/261 of O70351
- S155 (= S137) binding
- Y168 (= Y150) active site, Proton acceptor
1e6wC Rat brain 3-hydroxyacyl-coa dehydrogenase binary complex with nadh and estradiol (see paper)
34% identity, 67% coverage: 3:189/280 of query aligns to 3:201/248 of 1e6wC
- active site: G15 (= G15), N115 (= N109), T147 (≠ I135), S149 (= S137), Y162 (= Y150), K166 (= K154), F195 (= F183)
- binding estradiol: Q159 (≠ W147), Y162 (= Y150), L200 (= L188)
- binding nicotinamide-adenine-dinucleotide: G11 (= G11), S14 (≠ K14), G15 (= G15), L16 (= L16), D35 (≠ S35), V36 (≠ R36), N58 (= N58), V59 (≠ L59), C85 (≠ N85), A86 (= A86), T147 (≠ I135), Y162 (= Y150), K166 (= K154), P192 (= P180), L194 (≠ A182), F195 (= F183), T197 (= T185), L199 (≠ F187)
4bmsF Short chain alcohol dehydrogenase from ralstonia sp. Dsm 6428 in complex with NADPH
29% identity, 83% coverage: 5:236/280 of query aligns to 7:229/249 of 4bmsF
- active site: S137 (= S137), H147 (≠ W147), Y150 (= Y150), K154 (= K154), Q195 (≠ Y203)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G11), N15 (≠ S13), S16 (≠ K14), I18 (≠ L16), R38 (= R36), R39 (≠ N37), A59 (≠ V57), D60 (≠ N58), V61 (≠ L59), N87 (= N85), S88 (≠ A86), G89 (= G87), V110 (= V108), S137 (= S137), Y150 (= Y150), K154 (= K154), G181 (= G181), I183 (≠ F183), T185 (= T185), I187 (≠ F187)
4nbtA Crystal structure of fabg from acholeplasma laidlawii (see paper)
33% identity, 66% coverage: 5:188/280 of query aligns to 6:185/239 of 4nbtA
- active site: G16 (= G15), S132 (= S137), Y145 (= Y150), K149 (= K154)
- binding nicotinamide-adenine-dinucleotide: G12 (= G11), K15 (= K14), G16 (= G15), L17 (= L16), D36 (≠ N37), L37 (≠ I38), L52 (= L53), N53 (= N58), V54 (≠ L59), N80 (= N85), A81 (= A86), G82 (= G87), I130 (= I135), S132 (= S137), Y145 (= Y150), K149 (= K154), P177 (= P180), G178 (= G181), I180 (≠ F183), T182 (= T185)
1edoA The x-ray structure of beta-keto acyl carrier protein reductase from brassica napus complexed with NADP+ (see paper)
34% identity, 66% coverage: 6:190/280 of query aligns to 3:190/244 of 1edoA
- active site: G12 (= G15), S138 (= S137), Y151 (= Y150), K155 (= K154)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G11), S10 (= S13), R11 (≠ K14), I13 (≠ L16), N31 (vs. gap), Y32 (vs. gap), A33 (= A32), R34 (≠ A33), S35 (≠ T34), D59 (≠ N58), V60 (≠ L59), N86 (= N85), A87 (= A86), S138 (= S137), Y151 (= Y150), K155 (= K154), P181 (= P180), G182 (= G181), I184 (≠ R184), S186 (= S186), M188 (≠ L188)
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
29% identity, 83% coverage: 5:236/280 of query aligns to 9:227/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G11), S17 (= S13), R18 (≠ K14), I20 (≠ L16), T40 (= T34), N62 (= N58), V63 (≠ L59), N89 (= N85), A90 (= A86), I92 (≠ Y88), V139 (≠ I135), S141 (= S137), Y154 (= Y150), K158 (= K154), P184 (= P180), G185 (= G181), I187 (≠ F183), T189 (= T185), M191 (≠ F187)
6ihhA Crystal structure of rasadh f12 from ralstonia.Sp in complex with NADPH and a6o
30% identity, 83% coverage: 5:236/280 of query aligns to 7:229/249 of 6ihhA
- binding (2R,3S)-2-ethyl-2-[(2E)-2-(6-methoxy-3,4-dihydro-2H-naphthalen-1-ylidene)ethyl]-3-oxidanyl-cyclopentan-1-one: S137 (= S137), H147 (≠ W147), Y150 (= Y150), L188 (= L188)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G11), N15 (≠ S13), S16 (≠ K14), G17 (= G15), I18 (≠ L16), R38 (= R36), R39 (≠ N37), D60 (≠ N58), V61 (≠ L59), N87 (= N85), S88 (≠ A86), G89 (= G87), V110 (= V108), T135 (≠ I135), S137 (= S137), Y150 (= Y150), K154 (= K154), P180 (= P180), G181 (= G181), A182 (= A182), I183 (≠ F183), T185 (= T185), S187 (≠ F187)
Sites not aligning to the query:
4dmmB 3-oxoacyl-[acyl-carrier-protein] reductase from synechococcus elongatus pcc 7942 in complex with NADP
31% identity, 76% coverage: 5:218/280 of query aligns to 6:235/240 of 4dmmB
- active site: G16 (= G15), S142 (= S137), Q152 (≠ W147), Y155 (= Y150), K159 (= K154)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G11), S14 (= S13), R15 (≠ K14), G16 (= G15), I17 (≠ L16), A37 (vs. gap), S38 (≠ A33), S39 (≠ T34), A62 (≠ V57), D63 (≠ N58), V64 (≠ L59), N90 (= N85), A91 (= A86), L113 (≠ V108), I140 (= I135), S142 (= S137), Y155 (= Y150), K159 (= K154), P185 (= P180), G186 (= G181), I188 (≠ F183), T190 (= T185), M192 (≠ F187)
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
29% identity, 83% coverage: 5:236/280 of query aligns to 9:223/243 of 4i08A
- active site: G19 (= G15), N113 (= N109), S141 (= S137), Q151 (≠ W147), Y154 (= Y150), K158 (= K154)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G11), S17 (= S13), R18 (≠ K14), I20 (≠ L16), T40 (= T34), N62 (= N58), V63 (≠ L59), N89 (= N85), A90 (= A86), G140 (≠ A136), S141 (= S137), Y154 (= Y150), K158 (= K154), P184 (= P180), G185 (= G181), T189 (= T185)
P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
30% identity, 67% coverage: 5:192/280 of query aligns to 6:193/244 of P0A2C9
- M125 (≠ L124) mutation to I: Loss of the temperature-sensitive phenotype; when associated with T-223.
Sites not aligning to the query:
- 223 A→T: Loss of the temperature-sensitive phenotype; when associated with I-125.
- 224 S→F: Distorts the local conformation and prevent stacking around Phe-221. The S224F mutation would additionally disrupt the hydrogen bond formed between Ser-224 and Glu-226.
Query Sequence
>CA265_RS09910 FitnessBrowser__Pedo557:CA265_RS09910
MGKKKVWFITGASKGLGLSLVHQLLNAGQYVAATSRNIGELKKAVNNDGGKFLPLAVNLA
NEQSVEDAIKATIAKFERIDVVINNAGYGIGGSIEELSDAETRNSFDVNVFGTLNVIRKA
SPYLRAQRAGHIINIASIAGIAGATGWAVYAAAKSAVIALSEVSAEDLKEFGIKVTVVAP
GAFRTSFLTADSLILAANPIAAYEEVRAIHSKYLKMDGQQIGDPEKAAAAMISLASMPNP
PLHLLLGNDAFQRANTKIESLQKEFKDWKAITISTDFDEN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory