SitesBLAST
Comparing CA265_RS09980 FitnessBrowser__Pedo557:CA265_RS09980 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3ijrF 2.05 angstrom resolution crystal structure of a short chain dehydrogenase from bacillus anthracis str. 'Ames ancestor' in complex with NAD+
58% identity, 98% coverage: 8:284/284 of query aligns to 13:290/290 of 3ijrF
- active site: G57 (= G51), S182 (= S176), L192 (= L186), Y195 (= Y189), K199 (= K193), K240 (= K234)
- binding magnesium ion: D55 (= D49), S56 (= S50), E80 (= E74)
- binding nicotinamide-adenine-dinucleotide: P21 (= P15), D55 (= D49), S56 (= S50), G57 (= G51), I58 (= I52), Y77 (= Y71), L78 (= L72), E80 (= E74), G103 (= G97), D104 (= D98), L105 (≠ V99), N131 (= N125), V132 (≠ A126), A133 (≠ G127), Q134 (≠ M128), I155 (≠ T149), T180 (= T174), S182 (= S176), Y195 (= Y189), K199 (= K193), P225 (= P219), G226 (= G220), P227 (= P221), I228 (≠ V222), T230 (= T224), L232 (= L226)
3i3oA 2.06 angstrom resolution crystal structure of a short chain dehydrogenase from bacillus anthracis str. 'Ames ancestor' in complex with NAD-acetone
58% identity, 98% coverage: 8:284/284 of query aligns to 5:282/282 of 3i3oA
- active site: G49 (= G51), S174 (= S176), L184 (= L186), Y187 (= Y189), K191 (= K193), K232 (= K234)
- binding magnesium ion: D47 (= D49), S48 (= S50), E72 (= E74)
- binding nicotinamide adenine dinucleotide acetone adduct: G45 (= G47), D47 (= D49), S48 (= S50), G49 (= G51), I50 (= I52), Y69 (= Y71), L70 (= L72), E72 (= E74), G95 (= G97), D96 (= D98), L97 (≠ V99), N123 (= N125), V124 (≠ A126), A125 (≠ G127), Q126 (≠ M128), Q127 (= Q129), I147 (≠ T149), T172 (= T174), S174 (= S176), Y187 (= Y189), K191 (= K193), P217 (= P219), G218 (= G220), I220 (≠ V222), T222 (= T224), L224 (= L226)
P0AG84 Uncharacterized oxidoreductase YghA; EC 1.-.-.- from Escherichia coli (strain K12) (see paper)
46% identity, 96% coverage: 8:280/284 of query aligns to 17:291/294 of P0AG84
- K39 (≠ E30) modified: N6-acetyllysine
3r3sA Structure of the ygha oxidoreductase from salmonella enterica
45% identity, 96% coverage: 8:280/284 of query aligns to 15:289/292 of 3r3sA
- active site: G58 (= G51), S184 (= S176), L194 (= L186), Y197 (= Y189), K201 (= K193), Q242 (≠ E233)
- binding magnesium ion: D56 (= D49), S57 (= S50), E82 (= E74)
- binding nicotinamide-adenine-dinucleotide: D56 (= D49), S57 (= S50), G58 (= G51), I59 (= I52), L79 (= L72), E82 (= E74), D106 (= D98), L107 (≠ V99), V133 (≠ N125), A134 (= A126), G135 (= G127), S184 (= S176), Y197 (= Y189), K201 (= K193), P227 (= P219), G228 (= G220), I230 (≠ V222), T232 (= T224), L234 (= L226), Q235 (≠ I227)
5jydB Crystal structure of a putative short chain dehydrogenase from burkholderia cenocepacia
44% identity, 96% coverage: 8:279/284 of query aligns to 15:288/292 of 5jydB
- active site: G58 (= G51), S184 (= S176), L194 (= L186), Y197 (= Y189), K201 (= K193), P242 (≠ K234)
- binding magnesium ion: D56 (= D49), S57 (= S50), E82 (= E74)
- binding nicotinamide-adenine-dinucleotide: G54 (= G47), D56 (= D49), S57 (= S50), G58 (= G51), I59 (= I52), L79 (= L72), E82 (= E74), D106 (= D98), I107 (≠ V99), N133 (= N125), A134 (= A126), A135 (≠ G127), T182 (= T174), S184 (= S176), Y197 (= Y189), K201 (= K193), P227 (= P219), G228 (= G220), P229 (= P221), Y230 (≠ V222), T232 (= T224), L234 (= L226), Q235 (≠ I227)
8bcjB Crystal structure of short-chain dehydrogenase pa3128 from pseudomonas aeruginosa pao1 in complex with NADP+
37% identity, 86% coverage: 36:279/284 of query aligns to 1:249/250 of 8bcjB
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G47), S13 (≠ D49), R14 (≠ S50), G15 (= G51), I16 (= I52), L36 (= L72), R37 (≠ N73), N38 (≠ E74), A61 (≠ G97), D62 (= D98), V63 (= V99), N89 (= N125), A90 (= A126), G91 (= G127), T113 (= T149), V143 (≠ T174), S145 (= S176), Y159 (= Y189), K163 (= K193), P189 (= P219), G190 (= G220), I192 (≠ V222), T194 (= T224), I196 (≠ L226), H197 (≠ I227)
4iqgD Crystal structure of bpro0239 oxidoreductase from polaromonas sp. Js666 in NADP bound form
36% identity, 85% coverage: 40:280/284 of query aligns to 2:248/248 of 4iqgD
- active site: G13 (= G51), N112 (= N150), S143 (= S176), Y154 (≠ L186), Y157 (= Y189), K161 (= K193)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G9 (= G47), S11 (≠ D49), R12 (≠ S50), G13 (= G51), I14 (= I52), N32 (≠ V70), A34 (≠ L72), S35 (≠ N73), N36 (≠ E74), A59 (≠ G97), D60 (= D98), V61 (= V99), N87 (= N125), A88 (= A126), G89 (= G127), V141 (≠ T174), S143 (= S176), Y157 (= Y189), K161 (= K193), P187 (= P219), G188 (= G220), I190 (≠ V222), T192 (= T224), I194 (≠ L226), H195 (≠ I227)
3ay6B Crystal structure of bacillus megaterium glucose dehydrogenase 4 a258f mutant in complex with nadh and d-glucose (see paper)
35% identity, 85% coverage: 38:279/284 of query aligns to 11:255/267 of 3ay6B
- active site: G24 (= G51), S151 (= S176), Y164 (= Y189), K168 (= K193)
- binding beta-D-glucopyranose: E102 (≠ Q129), S151 (= S176), H153 (≠ T178), W158 (≠ S183), Y164 (= Y189), N202 (≠ I227), K205 (≠ T230)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G20 (= G47), T23 (≠ S50), G24 (= G51), L25 (≠ I52), Y45 (≠ L72), D71 (= D98), V72 (= V99), N98 (= N125), A99 (= A126), G100 (= G127), V101 (≠ M128), M149 (≠ T174), S151 (= S176), Y164 (= Y189), K168 (= K193), P194 (= P219), G195 (= G220), M197 (≠ V222), T199 (= T224), P200 (= P225), I201 (≠ L226), N202 (≠ I227)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
37% identity, 86% coverage: 37:279/284 of query aligns to 4:241/244 of 4nbuB
- active site: G18 (= G51), N111 (= N150), S139 (= S176), Q149 (≠ L186), Y152 (= Y189), K156 (= K193)
- binding acetoacetyl-coenzyme a: D93 (= D134), K98 (= K137), S139 (= S176), N146 (≠ S183), V147 (≠ P184), Q149 (≠ L186), Y152 (= Y189), F184 (≠ P221), M189 (≠ L226), K200 (≠ S238)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G47), N17 (≠ S50), G18 (= G51), I19 (= I52), D38 (≠ Y71), F39 (≠ L72), V59 (≠ G97), D60 (= D98), V61 (= V99), N87 (= N125), A88 (= A126), G89 (= G127), I90 (≠ M128), T137 (= T174), S139 (= S176), Y152 (= Y189), K156 (= K193), P182 (= P219), F184 (≠ P221), T185 (≠ V222), T187 (= T224), M189 (≠ L226)
7v0hG Crystal structure of putative glucose 1-dehydrogenase from burkholderia cenocepacia in complex with NADP and a potential reaction product
35% identity, 86% coverage: 37:279/284 of query aligns to 8:251/253 of 7v0hG
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G47), S20 (≠ D49), K21 (≠ S50), G22 (= G51), I23 (= I52), A43 (≠ L72), S44 (≠ N73), S45 (≠ E74), G68 (= G97), D69 (= D98), V70 (= V99), N96 (= N125), S97 (≠ A126), G98 (= G127), Y100 (≠ P131), I144 (≠ T174), S146 (= S176), Y159 (= Y189), K163 (= K193), P189 (= P219), G190 (= G220), M191 (≠ P221), I192 (≠ V222), T194 (= T224), G196 (vs. gap), T197 (vs. gap)
- binding (2R)-2-(hydroxymethyl)pentanedioic acid: S146 (= S176), Y159 (= Y189), M191 (≠ P221), I202 (≠ L226)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
35% identity, 83% coverage: 43:279/284 of query aligns to 7:243/246 of 3osuA
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
35% identity, 83% coverage: 43:279/284 of query aligns to 4:236/239 of 3sj7A
- active site: G12 (= G51), S138 (= S176), Q148 (≠ L186), Y151 (= Y189), K155 (= K193)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G47), S10 (≠ D49), R11 (≠ S50), I13 (= I52), N31 (≠ V70), Y32 (= Y71), A33 (≠ L72), G34 (≠ N73), S35 (≠ E74), A58 (≠ G97), N59 (≠ D98), V60 (= V99), N86 (= N125), A87 (= A126), T109 (= T149), S138 (= S176), Y151 (= Y189), K155 (= K193), P181 (= P219), G182 (= G220)
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
37% identity, 86% coverage: 38:280/284 of query aligns to 2:242/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G47), M16 (≠ I52), D35 (= D75), I36 (= I76), I62 (≠ V99), N88 (= N125), G90 (= G127), I138 (≠ T174), S140 (= S176), Y152 (= Y189), K156 (= K193), I185 (≠ V222)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
37% identity, 86% coverage: 38:280/284 of query aligns to 3:243/248 of Q9KJF1
- S15 (= S50) binding
- D36 (= D75) binding
- D62 (= D98) binding
- I63 (≠ V99) binding
- N89 (= N125) binding
- Y153 (= Y189) binding
- K157 (= K193) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
Q5P5I4 (S)-1-Phenylethanol dehydrogenase; EC 1.1.1.311 from Aromatoleum aromaticum (strain EbN1) (Azoarcus sp. (strain EbN1)) (see 2 papers)
38% identity, 86% coverage: 37:281/284 of query aligns to 4:247/249 of Q5P5I4
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
2ewmB Crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1 (see paper)
38% identity, 86% coverage: 37:281/284 of query aligns to 2:245/247 of 2ewmB
- active site: G16 (= G51), S139 (= S176), Y149 (≠ L186), Y152 (= Y189), K156 (= K193)
- binding nicotinamide-adenine-dinucleotide: G12 (= G47), N15 (≠ S50), G16 (= G51), I17 (= I52), D36 (≠ Y71), L37 (= L72), C59 (≠ G97), D60 (= D98), V61 (= V99), N87 (= N125), S139 (= S176), Y152 (= Y189), K156 (= K193), P182 (= P219), S183 (≠ G220), L184 (≠ P221), V185 (= V222), T189 (≠ L226)
P40288 Glucose 1-dehydrogenase; EC 1.1.1.47 from Priestia megaterium (Bacillus megaterium) (see 2 papers)
32% identity, 85% coverage: 38:279/284 of query aligns to 5:249/261 of P40288
- 11:35 (vs. 44:68, 48% identical) binding
- E96 (≠ Q129) mutation E->A,G,K: Heat stable.
- D108 (≠ Q142) mutation to N: Heat stable.
- V112 (≠ T146) mutation to A: Heat stable.
- E133 (≠ P167) mutation to K: Heat stable.
- V183 (= V214) mutation to I: Heat stable.
- P194 (= P225) mutation to Q: Heat stable.
- E210 (≠ G240) mutation to K: Heat stable.
- Y217 (≠ R247) mutation to H: Heat stable.
Sites not aligning to the query:
- 252 Q→L: Heat stable.
- 253 Y→C: Heat stable.
- 258 A→G: Heat stable.
1g6kA Crystal structure of glucose dehydrogenase mutant e96a complexed with NAD+
32% identity, 85% coverage: 38:279/284 of query aligns to 5:249/261 of 1g6kA
- active site: G18 (= G51), S145 (= S176), Y158 (= Y189), K162 (= K193)
- binding nicotinamide-adenine-dinucleotide: T17 (≠ S50), G18 (= G51), L19 (≠ I52), R39 (≠ L72), D65 (= D98), V66 (= V99), N92 (= N125), A93 (= A126), G94 (= G127), M143 (≠ T174), S145 (= S176), Y158 (= Y189), P188 (= P219), G189 (= G220), I191 (≠ V222), T193 (= T224)
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
32% identity, 87% coverage: 38:283/284 of query aligns to 4:252/252 of 1vl8B
- active site: G17 (= G51), S143 (= S176), I154 (≠ L186), Y157 (= Y189), K161 (= K193)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G47), R16 (≠ S50), G17 (= G51), L18 (≠ I52), S37 (≠ Y71), R38 (≠ L72), C63 (≠ G97), D64 (= D98), V65 (= V99), A91 (≠ N125), A92 (= A126), G93 (= G127), I94 (≠ M128), V114 (≠ T149), I141 (≠ T174), S143 (= S176), Y157 (= Y189), K161 (= K193), P187 (= P219), G188 (= G220), Y190 (≠ V222), T192 (= T224), M194 (≠ L226), T195 (≠ I227)
4bmsF Short chain alcohol dehydrogenase from ralstonia sp. Dsm 6428 in complex with NADPH
36% identity, 86% coverage: 37:279/284 of query aligns to 3:245/249 of 4bmsF
- active site: S137 (= S176), H147 (≠ L186), Y150 (= Y189), K154 (= K193), Q195 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G47), N15 (≠ D49), S16 (= S50), I18 (= I52), R38 (≠ L72), R39 (≠ N73), A59 (≠ G97), D60 (= D98), V61 (= V99), N87 (= N125), S88 (≠ A126), G89 (= G127), V110 (≠ T149), S137 (= S176), Y150 (= Y189), K154 (= K193), G181 (= G220), I183 (≠ V222), T185 (= T224), I187 (≠ L226)
Query Sequence
>CA265_RS09980 FitnessBrowser__Pedo557:CA265_RS09980
MMKSQKTPAKQHQQPGIEAKMNPRPEVIKENYRGAGKLNNQVALITGGDSGIGRSVAVHF
AREGADVAIVYLNEDIDAKETQKMVEAEGKKCLLIKGDVKKPAFCKKAVENTIKQFGKIN
ILVNNAGMQVPQKDPKKIDNKQLEDTFRTNIFGYFYFAHEVLEHFKPGDSIINTTSVTAY
RSSPNLIDYSSTKGAITSFTRSLATNLATKGIRVNAVAPGPVWTPLIVSTFDEKKIKSFG
SQTAMERAGQPSEIAPAYVFLASDDASFITGQVIHVNGGEVVNG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory