SitesBLAST
Comparing CA265_RS10080 CA265_RS10080 acetate kinase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
P38502 Acetate kinase; Acetokinase; EC 2.7.2.1 from Methanosarcina thermophila (see 5 papers)
50% identity, 99% coverage: 1:395/398 of query aligns to 1:394/408 of P38502
- N7 (= N7) mutation to A: Almost abolishes catalytic activity. Requires increased magnesium levels for activity. Strongly decreases affinity for acetate.; mutation to D: Almost abolishes catalytic activity. Strongly decreases affinity for acetate.
- S10 (= S10) mutation S->A,T: Strongly decreases catalytic activity. Strongly decreases affinity for acetate.
- S12 (= S12) mutation to A: Decreases catalytic activity. Strongly decreases affinity for acetate. Requires increased magnesium levels for enzyme activity.; mutation to T: Decreases catalytic activity. Strongly decreases affinity for acetate.
- K14 (= K14) mutation to A: Strongly decreases enzyme activity.; mutation to R: Reduces enzyme activity.
- R91 (= R94) mutation R->A,L: Decreases catalytic activity. Decreases affinity for acetate.
- V93 (= V96) mutation to A: Decreases affinity for acetate.
- L122 (= L125) mutation to A: Decreases affinity for acetate.
- D148 (= D151) active site, Proton donor/acceptor; mutation D->A,E,N: Abolishes catalytic activity. Decreases affinity for acetate, but not for ATP.
- F179 (= F182) mutation to A: Decreases affinity for acetate.
- N211 (= N212) mutation to A: Slightly reduced enzyme activity.
- P232 (= P233) mutation to A: Decreases affinity for acetate.
- R241 (= R242) mutation R->K,L: Decreases catalytic activity. Strongly reduced affinity for ATP.
- E384 (= E385) mutation to A: Almost abolishes catalytic activity. Strongly decreases affinity for acetate. Requires strongly increased magnesium levels for enzyme activity.
1tuuB Acetate kinase crystallized with atpgs (see paper)
50% identity, 99% coverage: 1:395/398 of query aligns to 1:394/398 of 1tuuB
- active site: N7 (= N7), R91 (= R94), H180 (= H183), R241 (= R242), E384 (= E385)
- binding adenosine monophosphate: D283 (= D283), R285 (= R285), G331 (= G331), I332 (≠ V332), N335 (= N335), S336 (≠ D336)
- binding trihydrogen thiodiphosphate: H180 (= H183), G212 (= G213), R241 (= R242)
1tuuA Acetate kinase crystallized with atpgs (see paper)
50% identity, 99% coverage: 1:395/398 of query aligns to 1:394/399 of 1tuuA
- active site: N7 (= N7), R91 (= R94), H180 (= H183), R241 (= R242), E384 (= E385)
- binding adenosine-5'-diphosphate: K14 (= K14), G210 (= G211), D283 (= D283), F284 (≠ M284), R285 (= R285), G331 (= G331), I332 (≠ V332), N335 (= N335)
- binding sulfate ion: R91 (= R94), H180 (= H183), G212 (= G213)
7fj9A Kpacka (pduw) with amppnp complex structure
48% identity, 98% coverage: 3:391/398 of query aligns to 4:386/395 of 7fj9A
7fj8A Kpacka (pduw) with amp complex structure
48% identity, 98% coverage: 3:391/398 of query aligns to 4:386/395 of 7fj8A
4ijnA Crystal structure of an acetate kinase from mycobacterium smegmatis bound to amp and sulfate (see paper)
42% identity, 99% coverage: 1:393/398 of query aligns to 2:373/376 of 4ijnA
- active site: N8 (= N7), R72 (= R94), H161 (= H183), R222 (= R242), E365 (= E385)
- binding adenosine monophosphate: G191 (= G211), N192 (= N212), D263 (= D283), F264 (≠ M284), R265 (= R285), G311 (= G331), V312 (= V332), N315 (= N335), V316 (≠ D336)
4iz9A Crystal structure of an acetate kinase from mycobacterium avium bound to an unknown acid-apcpp conjugate and manganese (see paper)
41% identity, 99% coverage: 2:397/398 of query aligns to 5:379/381 of 4iz9A
- active site: N10 (= N7), R74 (= R94), H163 (= H183), R224 (= R242), E367 (= E385)
- binding diphosphomethylphosphonic acid adenosyl ester: K17 (= K14), G193 (= G211), N194 (= N212), D265 (= D283), F266 (≠ M284), R267 (= R285), G313 (= G331), I314 (≠ V332), N317 (= N335), D318 (= D336)
4fwsA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with ctp (see paper)
42% identity, 97% coverage: 3:390/398 of query aligns to 4:383/394 of 4fwsA
- active site: N8 (= N7), R83 (= R94), H172 (= H183), R233 (= R242), E378 (= E385)
- binding cytidine-5'-triphosphate: G202 (= G211), N203 (= N212), G204 (= G213), D275 (= D283), L276 (≠ M284), R277 (= R285), G323 (= G331), I324 (≠ V332), N327 (= N335)
- binding 1,2-ethanediol: V21 (≠ M20), C24 (≠ K23), H115 (= H126), N203 (= N212), T232 (= T241), R233 (= R242), K262 (= K271)
4fwrA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with cmp (see paper)
42% identity, 97% coverage: 3:390/398 of query aligns to 4:383/394 of 4fwrA
- active site: N8 (= N7), R83 (= R94), H172 (= H183), R233 (= R242), E378 (= E385)
- binding cytidine-5'-monophosphate: G202 (= G211), N203 (= N212), D275 (= D283), L276 (≠ M284), R277 (= R285), G323 (= G331), I324 (≠ V332), N327 (= N335)
4fwqA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with gtp (see paper)
42% identity, 97% coverage: 3:390/398 of query aligns to 4:383/394 of 4fwqA
- active site: N8 (= N7), R83 (= R94), H172 (= H183), R233 (= R242), E378 (= E385)
- binding guanosine-5'-triphosphate: H172 (= H183), N203 (= N212), G204 (= G213), D275 (= D283), L276 (≠ M284), R277 (= R285), E280 (≠ R288), G323 (= G331), I324 (≠ V332), N327 (= N335)
4fwpA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with gdp (see paper)
42% identity, 97% coverage: 3:390/398 of query aligns to 4:383/394 of 4fwpA
- active site: N8 (= N7), R83 (= R94), H172 (= H183), R233 (= R242), E378 (= E385)
- binding 1,2-ethanediol: S11 (= S10), H115 (= H126), K262 (= K271)
- binding guanosine-5'-diphosphate: N203 (= N212), D275 (= D283), L276 (≠ M284), R277 (= R285), E280 (≠ R288), G323 (= G331), I324 (≠ V332), N327 (= N335), S328 (≠ D336)
4fwoA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with gmp (see paper)
42% identity, 97% coverage: 3:390/398 of query aligns to 4:383/394 of 4fwoA
- active site: N8 (= N7), R83 (= R94), H172 (= H183), R233 (= R242), E378 (= E385)
- binding guanosine-5'-monophosphate: G202 (= G211), N203 (= N212), D275 (= D283), L276 (≠ M284), R277 (= R285), E280 (≠ R288), G323 (= G331), I324 (≠ V332), N327 (= N335)
- binding 1,2-ethanediol: E100 (= E111), N104 (≠ Q115)
4fwnA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with adenosine tetraphosphate (ap4) (see paper)
42% identity, 97% coverage: 3:390/398 of query aligns to 4:383/394 of 4fwnA
- active site: N8 (= N7), R83 (= R94), H172 (= H183), R233 (= R242), E378 (= E385)
- binding adenosine-5'-tetraphosphate: H172 (= H183), H200 (= H209), N203 (= N212), G204 (= G213), D275 (= D283), L276 (≠ M284), R277 (= R285), G323 (= G331), I324 (≠ V332), N327 (= N335)
4fwmA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with atp (see paper)
42% identity, 97% coverage: 3:390/398 of query aligns to 4:383/394 of 4fwmA
- active site: N8 (= N7), R83 (= R94), H172 (= H183), R233 (= R242), E378 (= E385)
- binding adenosine-5'-triphosphate: H172 (= H183), H200 (= H209), N203 (= N212), G204 (= G213), D275 (= D283), L276 (≠ M284), R277 (= R285), G323 (= G331), I324 (≠ V332), N327 (= N335)
- binding 1,2-ethanediol: H172 (= H183), R233 (= R242)
4fwkA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with amp (see paper)
42% identity, 97% coverage: 3:390/398 of query aligns to 4:383/394 of 4fwkA
- active site: N8 (= N7), R83 (= R94), H172 (= H183), R233 (= R242), E378 (= E385)
- binding adenosine monophosphate: G202 (= G211), N203 (= N212), D275 (= D283), L276 (≠ M284), R277 (= R285), G323 (= G331), I324 (≠ V332), N327 (= N335)
- binding 1,2-ethanediol: D103 (≠ H114), N104 (≠ Q115), R107 (≠ K118)
2e1zA Crystal structure of salmonella typhimurium propionate kinase (tdcd) in complex with diadenosine tetraphosphate (ap4a) obtained after co- crystallization with atp (see paper)
42% identity, 97% coverage: 3:390/398 of query aligns to 4:383/394 of 2e1zA
- active site: N8 (= N7), R83 (= R94), H172 (= H183), R233 (= R242), E378 (= E385)
- binding bis(adenosine)-5'-tetraphosphate: N8 (= N7), R83 (= R94), H115 (= H126), G202 (= G211), N203 (= N212), G204 (= G213), P224 (= P233), R233 (= R242), D275 (= D283), L276 (≠ M284), R277 (= R285), G323 (= G331), I324 (≠ V332), N327 (= N335)
1x3nA Crystal structure of amppnp bound propionate kinase (tdcd) from salmonella typhimurium (see paper)
42% identity, 97% coverage: 3:390/398 of query aligns to 4:383/394 of 1x3nA
- active site: N8 (= N7), R83 (= R94), H172 (= H183), R233 (= R242), E378 (= E385)
- binding phosphoaminophosphonic acid-adenylate ester: G202 (= G211), N203 (= N212), G204 (= G213), D275 (= D283), L276 (≠ M284), R277 (= R285), G323 (= G331), I324 (≠ V332), N327 (= N335)
1x3mA Crystal structure of adp bound propionate kinase (tdcd) from salmonella typhimurium (see paper)
42% identity, 97% coverage: 3:390/398 of query aligns to 4:383/394 of 1x3mA
- active site: N8 (= N7), R83 (= R94), H172 (= H183), R233 (= R242), E378 (= E385)
- binding adenosine-5'-diphosphate: G202 (= G211), N203 (= N212), D275 (= D283), L276 (≠ M284), R277 (= R285), G322 (≠ A330), G323 (= G331), I324 (≠ V332), N327 (= N335)
1sazA Membership in the askha superfamily: enzymological properties and crystal structure of butyrate kinase 2 from thermotoga maritima (see paper)
31% identity, 38% coverage: 182:332/398 of query aligns to 153:305/375 of 1sazA
Sites not aligning to the query:
Query Sequence
>CA265_RS10080 CA265_RS10080 acetate kinase
MNILVINSGSSSLKYQLFNMPEKAPLCSGLVERIGIEGSFIKHSVYRNNEKYNIEQSGFI
ANHGEGLKQVLALLTEGEYAVIASPDDIAAVGHRVVHGGEHFTGATLITDEVKHQIKKLF
SLAPLHNPVNYKCIEVAEQTFVNAKQIAVFDTAFHQTIPEQAYRYAIPEWYYKEHGIRVY
GFHGTSHKYVSEQAIKWLNKAESKIISIHLGNGCSITAIKNGKSIDTSMGFGPLSGLMMG
TRSGDIDPSVIFHLMEHSGYTLEQLSTLVNKQSGLLGVGGSSDMRDIRKMVSEGNAAAIL
ALKLYAYRIKKFIGAYAAILNGIDAIVFTAGVGENDSNMREAVCSALDYLGIELDPNQNA
AYHGALKEINKTGAKVKILVIPTNEEYEIAHQCFERLT
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory