Comparing CA265_RS10150 FitnessBrowser__Pedo557:CA265_RS10150 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P16703 Cysteine synthase B; CSase B; O-acetylserine (thiol)-lyase B; OAS-TL B; O-acetylserine sulfhydrylase B; EC 2.5.1.47 from Escherichia coli (strain K12) (see paper)
55% identity, 100% coverage: 1:290/290 of query aligns to 1:293/303 of P16703
2bhtA Crystal structure of o-acetylserine sulfhydrylase b (see paper)
54% identity, 100% coverage: 1:290/290 of query aligns to 1:293/294 of 2bhtA
5xoqA Crystal structure of o-acetylserine sulfhydrylase with bound transcription factor peptide inhibitor from planctomyces limnophilus
39% identity, 97% coverage: 8:289/290 of query aligns to 12:306/310 of 5xoqA
4jblB Crystal structure of o-acetyl serine sulfhydrylase from entamoeba histolytica in complex with methionine (see paper)
38% identity, 99% coverage: 4:289/290 of query aligns to 16:318/335 of 4jblB
3bm5B Crystal structure of o-acetyl-serine sulfhydrylase from entamoeba histolytica in complex with cysteine (see paper)
38% identity, 99% coverage: 4:289/290 of query aligns to 16:318/335 of 3bm5B
4jbnA Crystal structure of o-acetyl serine sulfhydrylase from entamoeba histolytica in complex with serine acetyl transferase derived tetrapeptide, spsi (see paper)
38% identity, 99% coverage: 4:289/290 of query aligns to 16:318/336 of 4jbnA
4il5A Crystal structure of o-acetyl serine sulfhydrylase from entamoeba histolytica in complex with isoleucine (see paper)
38% identity, 99% coverage: 4:289/290 of query aligns to 16:318/336 of 4il5A
3bm5A Crystal structure of o-acetyl-serine sulfhydrylase from entamoeba histolytica in complex with cysteine (see paper)
38% identity, 99% coverage: 4:289/290 of query aligns to 16:318/338 of 3bm5A
2efyA Crystal structure of t.Th. Hb8 o-acetylserine sulfhydrylase complexed with 4-acetylbutyric acid
41% identity, 97% coverage: 8:289/290 of query aligns to 7:301/302 of 2efyA
2ecqA Crystal structure of t.Th. Hb8 o-acetylserine sulfhydrylase complexed with 3-hydroxylactate
41% identity, 97% coverage: 8:289/290 of query aligns to 7:301/302 of 2ecqA
2ecoA Crystal structure of t.Th. Hb8 o-acetylserine sulfhydrylase complexed with 4-methylvalerate
41% identity, 97% coverage: 8:289/290 of query aligns to 7:301/302 of 2ecoA
Q93244 Cysteine synthase 1; O-acetylserine (thiol)-lyase 1; OAS-TL; EC 2.5.1.47 from Caenorhabditis elegans (see 2 papers)
38% identity, 98% coverage: 7:289/290 of query aligns to 14:310/341 of Q93244
P0ABK5 Cysteine synthase A; CSase A; O-acetylserine (thiol)-lyase A; OAS-TL A; O-acetylserine sulfhydrylase A; S-carboxymethylcysteine synthase; Sulfate starvation-induced protein 5; SSI5; EC 2.5.1.47; EC 4.5.1.5 from Escherichia coli (strain K12) (see 5 papers)
40% identity, 97% coverage: 8:289/290 of query aligns to 12:312/323 of P0ABK5
Sites not aligning to the query:
6kr5B Crystal structure of o-acetyl serine sulfhydrylase isoform 3 from entamoeba histolytica (see paper)
37% identity, 99% coverage: 4:289/290 of query aligns to 15:317/336 of 6kr5B
6z4nAAA structure of oass complexed with upar inhibitor (see paper)
40% identity, 97% coverage: 8:289/290 of query aligns to 13:313/321 of 6z4nAAA
P0A1E3 Cysteine synthase A; CSase A; O-acetylserine (thiol)-lyase A; OAS-TL A; O-acetylserine sulfhydrylase A; EC 2.5.1.47 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 4 papers)
40% identity, 97% coverage: 8:289/290 of query aligns to 12:312/323 of P0A1E3
Sites not aligning to the query:
4aecA Crystal structure of the arabidopsis thaliana o-acetyl-serine-(thiol)- lyasE C (see paper)
41% identity, 98% coverage: 6:289/290 of query aligns to 19:316/323 of 4aecA
P47999 Cysteine synthase, chloroplastic/chromoplastic; At.OAS.7-4; Beta-substituted Ala synthase 2;1; ARAth-Bsas2;1; CSase B; AtCS-B; CS-B; O-acetylserine (thiol)-lyase; O-acetylserine sulfhydrylase; OAS-TL B; cpACS1; EC 2.5.1.47 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
40% identity, 98% coverage: 6:289/290 of query aligns to 81:378/392 of P47999
Sites not aligning to the query:
3vbeC Crystal structure of beta-cyanoalanine synthase in soybean (see paper)
38% identity, 99% coverage: 4:289/290 of query aligns to 15:314/329 of 3vbeC
1d6sA Crystal structure of the k41a mutant of o-acetylserine sulfhydrylase complexed in external aldimine linkage with methionine (see paper)
39% identity, 97% coverage: 8:289/290 of query aligns to 11:311/322 of 1d6sA
>CA265_RS10150 FitnessBrowser__Pedo557:CA265_RS10150
MAGIIDLIGNTPMAELQKLNINPAVRVFAKLEGNNPGGSVKDRASLNMIRSAIERGDVVP
GTKLVEATSGNTGIALAMIASLYNLEIELVMPANSTRERKVTMEAFGAKVTLLESIEDCR
DYAEEKGVSKGYFLLNQFANPDNYLAHYKTTGPEIWRDTEGEITHFVSSMGTTGTIMGCS
RFFKEKNNDIQIIGCQPTEGSSIPGIRRWPEEYLPKIFDPLRVDRVMDIAQEEATLMSRR
MAKEEGLFAGMSSGGACAAALKLASELDKGTIVFIACDRGDRYLSSDLFG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory