Comparing CA265_RS10155 FitnessBrowser__Pedo557:CA265_RS10155 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 16 hits to proteins with known functional sites (download)
3p47A Crystal structure of entamoeba histolytica serine acetyltransferase 1 in complex with l-cysteine (see paper)
42% identity, 87% coverage: 21:256/270 of query aligns to 32:269/270 of 3p47A
3q1xA Crystal structure of entamoeba histolytica serine acetyltransferase 1 in complex with l-serine (see paper)
42% identity, 87% coverage: 21:256/270 of query aligns to 30:267/267 of 3q1xA
7bw9A Crystal structure of serine acetyltransferase isoform 3 in complex with cysteine from entamoeba histolytica
43% identity, 81% coverage: 31:249/270 of query aligns to 39:252/280 of 7bw9A
4n69A Soybean serine acetyltransferase complexed with serine (see paper)
36% identity, 65% coverage: 85:259/270 of query aligns to 70:239/243 of 4n69A
1ssqD Serine acetyltransferase- complex with cysteine (see paper)
35% identity, 68% coverage: 85:267/270 of query aligns to 67:244/257 of 1ssqD
6wyeA Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) (see paper)
37% identity, 60% coverage: 93:253/270 of query aligns to 80:236/261 of 6wyeA
1t3dA Crystal structure of serine acetyltransferase from e.Coli at 2.2a (see paper)
35% identity, 63% coverage: 89:259/270 of query aligns to 75:240/262 of 1t3dA
7ra4A Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) in complex with serine (see paper)
37% identity, 60% coverage: 93:253/270 of query aligns to 78:234/243 of 7ra4A
4hzdA Crystal structure of serine acetyltransferase in complex with coenzyme a from brucella abortus strain s19 (see paper)
36% identity, 62% coverage: 84:250/270 of query aligns to 70:231/250 of 4hzdA
Sites not aligning to the query:
3gvdI Crystal structure of serine acetyltransferase cyse from yersinia pestis
38% identity, 60% coverage: 98:259/270 of query aligns to 87:243/272 of 3gvdI
1sstA Serine acetyltransferase- complex with coa (see paper)
35% identity, 66% coverage: 83:259/270 of query aligns to 65:229/233 of 1sstA
Sites not aligning to the query:
8i09A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with butyl gallate (see paper)
36% identity, 63% coverage: 89:259/270 of query aligns to 74:239/246 of 8i09A
8i06A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with coa (see paper)
36% identity, 63% coverage: 89:259/270 of query aligns to 75:240/244 of 8i06A
8i04A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with serine (see paper)
36% identity, 63% coverage: 89:259/270 of query aligns to 71:236/258 of 8i04A
4n6bA Soybean serine acetyltransferase complexed with coa (see paper)
35% identity, 65% coverage: 85:259/270 of query aligns to 66:229/233 of 4n6bA
4h7oA Crystal structure of serine acetyltransferase from vibrio cholerae o1 biovar el tor n16961
31% identity, 66% coverage: 83:259/270 of query aligns to 65:236/258 of 4h7oA
Sites not aligning to the query:
>CA265_RS10155 FitnessBrowser__Pedo557:CA265_RS10155
MEDHFFEQIIKNPLEQPNIPPNEVISRWAEKLIQVLFPENSPKVFSTITEVKEYIAVLEL
ELYDIISASCRLKNSECKNAAGQFFEELPALYRVLNTDIVAIYEGDPAAQSRFEVIRTYP
GFYAICFYRIAHMLYNFGIPLVPRILTEYAHSKTGIDIHPAASIGEYFHIDHGTGIVIGE
TSTIGRYVKLYQGVTLGALSVKKTLAGSKRHPTVEDRVVIYSGATILGGETIIGHDSIIG
GNVWLTESIPAFSTAYHSPIITIRNHKETN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory