SitesBLAST
Comparing CA265_RS10420 FitnessBrowser__Pedo557:CA265_RS10420 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5z20F The ternary structure of d-lactate dehydrogenase from pseudomonas aeruginosa with nadh and oxamate (see paper)
51% identity, 98% coverage: 1:328/334 of query aligns to 8:334/336 of 5z20F
- active site: S108 (= S102), R241 (= R235), D265 (= D259), E270 (= E264), H302 (= H296)
- binding 1,4-dihydronicotinamide adenine dinucleotide: Y107 (= Y101), G160 (= G154), Q161 (≠ E155), I162 (= I156), Y180 (≠ F174), D181 (= D175), P182 (= P176), C212 (= C206), P213 (= P207), T218 (≠ N212), T239 (= T233), G240 (≠ S234), R241 (= R235), H302 (= H296), A304 (= A298)
4cukA Structure of salmonella d-lactate dehydrogenase in complex with nadh
52% identity, 97% coverage: 1:324/334 of query aligns to 1:323/330 of 4cukA
- active site: S101 (= S102), R234 (= R235), D258 (= D259), E263 (= E264), H295 (= H296)
- binding 1,4-dihydronicotinamide adenine dinucleotide: Y100 (= Y101), G153 (= G154), K154 (≠ E155), I155 (= I156), F173 (= F174), D174 (= D175), P175 (= P176), H204 (= H205), C205 (= C206), P206 (= P207), N211 (= N212), T232 (= T233), Y260 (= Y261), H295 (= H296), A297 (= A298)
8grvA Dictyostelium discoideum lactate dehydrogenase (dicldha)with NAD
46% identity, 94% coverage: 1:315/334 of query aligns to 3:317/336 of 8grvA
- binding nicotinamide-adenine-dinucleotide: V106 (= V106), G154 (= G154), N155 (≠ E155), I156 (= I156), D176 (= D175), I177 (≠ P176), I178 (≠ F177), T208 (≠ C206), P209 (= P207), T214 (≠ N212), V235 (≠ T233), H298 (= H296), A300 (= A298), W301 (≠ F299)
5z21B The ternary structure of d-lactate dehydrogenase from fusobacterium nucleatum with nadh and oxamate (see paper)
47% identity, 96% coverage: 2:323/334 of query aligns to 3:323/331 of 5z21B
- active site: S101 (= S102), R235 (= R235), D259 (= D259), E264 (= E264), H296 (= H296)
- binding 1,4-dihydronicotinamide adenine dinucleotide: Y100 (= Y101), I105 (≠ V106), G153 (= G154), K154 (≠ E155), I155 (= I156), D174 (= D175), L175 (≠ P176), P207 (= P207), T212 (≠ N212), T233 (= T233), G234 (≠ S234), R235 (= R235), H296 (= H296), Y299 (≠ F299)
4zgsA Identification of the pyruvate reductase of chlamydomonas reinhardtii (see paper)
45% identity, 94% coverage: 2:316/334 of query aligns to 12:331/346 of 4zgsA
- active site: S111 (= S102), R244 (= R235), D268 (= D259), E273 (= E264), H311 (= H296)
- binding nicotinamide-adenine-dinucleotide: Y110 (= Y101), G163 (= G154), A164 (≠ E155), I165 (= I156), D184 (= D175), C215 (= C206), P216 (= P207), L218 (≠ T209), S220 (≠ E211), T221 (≠ N212), S243 (= S234), H311 (= H296), F314 (= F299)
3kb6B Crystal structure of d-lactate dehydrogenase from aquifex aeolicus complexed with NAD and lactic acid (see paper)
36% identity, 98% coverage: 1:326/334 of query aligns to 1:324/334 of 3kb6B
- active site: S97 (= S102), R231 (= R235), D255 (= D259), E260 (= E264), H294 (= H296)
- binding lactic acid: F49 (= F52), S72 (≠ C77), V73 (≠ A78), G74 (= G79), Y96 (= Y101), R231 (= R235), H294 (= H296)
- binding nicotinamide-adenine-dinucleotide: V73 (≠ A78), Y96 (= Y101), V101 (= V106), G150 (= G154), R151 (≠ E155), I152 (= I156), D171 (= D175), V172 (≠ P176), P203 (= P207), T229 (= T233), A230 (≠ S234), R231 (= R235), H294 (= H296), A296 (= A298), Y297 (≠ F299)
2dldA D-lactate dehydrogenase complexed with nadh and oxamate
35% identity, 99% coverage: 1:329/334 of query aligns to 1:331/337 of 2dldA
- active site: S103 (= S102), R236 (= R235), D260 (= D259), E265 (= E264), H297 (= H296)
- binding 1,4-dihydronicotinamide adenine dinucleotide: T154 (= T153), G155 (= G154), H156 (≠ E155), I157 (= I156), D176 (= D175), I177 (≠ P176), V207 (≠ C206), P208 (= P207), N213 (= N212), C234 (≠ T233), S235 (= S234), H297 (= H296)
Sites not aligning to the query:
P30901 D-lactate dehydrogenase; D-LDH; D-specific 2-hydroxyacid dehydrogenase; EC 1.1.1.28 from Lactobacillus helveticus (Lactobacillus suntoryeus) (see paper)
35% identity, 99% coverage: 1:329/334 of query aligns to 1:331/337 of P30901
- M1 (= M1) modified: Initiator methionine, Removed
- D176 (= D175) binding
- VP 207:208 (≠ CP 206:207) binding
- N213 (= N212) binding
- D260 (= D259) binding
P26297 D-lactate dehydrogenase; D-LDH; D-specific 2-hydroxyacid dehydrogenase; EC 1.1.1.28 from Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14) (see 2 papers)
36% identity, 91% coverage: 2:305/334 of query aligns to 3:306/333 of P26297
- HI 156:157 (≠ EI 155:156) binding
- D176 (= D175) binding
- H206 (= H205) mutation to Q: Increase of activity.
- VP 207:208 (≠ CP 206:207) binding
- N213 (= N212) binding
- R236 (= R235) mutation to K: Decrease of activity.
- D260 (= D259) binding ; mutation to N: Decrease of activity.
- E265 (= E264) mutation to Q: Decrease of activity.
- H297 (= H296) mutation to Q: 90% loss of activity.
1j49A Insights into domain closure, substrate specificity and catalysis of d-lactate dehydrogenase from lactobacillus bulgaricus (see paper)
36% identity, 89% coverage: 9:305/334 of query aligns to 14:306/332 of 1j49A
- active site: S103 (= S102), R236 (= R235), D260 (= D259), E265 (= E264), H297 (= H296)
- binding nicotinamide-adenine-dinucleotide: Y102 (= Y101), I107 (≠ V106), G153 (= G152), G155 (= G154), I157 (= I156), Y175 (≠ F174), D176 (= D175), I177 (≠ P176), V207 (≠ C206), P208 (= P207), N213 (= N212), V234 (≠ T233), S235 (= S234), R236 (= R235), H297 (= H296), A299 (= A298), F300 (= F299)
4prlA Crystal structure of d-lactate dehydrogenase with NAD+ from lactobacillus jensenii (see paper)
34% identity, 94% coverage: 1:314/334 of query aligns to 1:313/330 of 4prlA
- binding nicotinamide-adenine-dinucleotide: Y101 (= Y101), I106 (≠ V106), V154 (≠ T153), G155 (= G154), H156 (≠ E155), I157 (= I156), Y175 (≠ F174), D176 (= D175), H205 (= H205), T206 (≠ C206), P207 (= P207), A233 (≠ T233), A234 (≠ S234), D259 (= D259), H295 (= H296), A297 (= A298)
1dxyA Structure of d-2-hydroxyisocaproate dehydrogenase (see paper)
32% identity, 99% coverage: 1:329/334 of query aligns to 1:329/330 of 1dxyA
- active site: S101 (= S102), R234 (= R235), D258 (= D259), E263 (= E264), H295 (= H296)
- binding 2-oxo-4-methylpentanoic acid: V77 (≠ A78), Y100 (= Y101), Y298 (≠ F299)
- binding nicotinamide-adenine-dinucleotide: Y100 (= Y101), G152 (= G152), G154 (= G154), H155 (≠ E155), I156 (= I156), Y174 (≠ F174), D175 (= D175), P176 (= P176), H204 (= H205), V205 (≠ C206), P206 (= P207), N211 (= N212), T232 (= T233), A233 (≠ S234), R234 (= R235), H295 (= H296), Y298 (≠ F299)
P17584 D-2-hydroxyisocaproate dehydrogenase; D-HICDH; EC 1.1.1.- from Lacticaseibacillus paracasei (Lactobacillus paracasei) (see paper)
32% identity, 99% coverage: 1:329/334 of query aligns to 1:329/333 of P17584
2yq5C Crystal structure of d-isomer specific 2-hydroxyacid dehydrogenase from lactobacillus delbrueckii ssp. Bulgaricus: NAD complexed form (see paper)
33% identity, 93% coverage: 2:313/334 of query aligns to 2:314/331 of 2yq5C
- active site: S102 (= S102), R236 (= R235), D260 (= D259), E265 (= E264), H297 (= H296)
- binding nicotinamide-adenine-dinucleotide: Y101 (= Y101), I106 (≠ V106), V155 (≠ T153), G156 (= G154), H157 (≠ E155), I158 (= I156), Y176 (≠ F174), D177 (= D175), V178 (≠ P176), H206 (= H205), T207 (≠ C206), P208 (= P207), A235 (≠ S234), R236 (= R235), H297 (= H296), F300 (= F299)
4xkjA A novel d-lactate dehydrogenase from sporolactobacillus sp
32% identity, 95% coverage: 1:316/334 of query aligns to 1:315/332 of 4xkjA
- active site: S102 (= S102), R234 (= R235), D258 (= D259), E263 (= E264), H295 (= H296)
- binding nicotinamide-adenine-dinucleotide: Y101 (= Y101), V106 (= V106), G152 (= G152), G154 (= G154), R155 (≠ E155), I156 (= I156), D175 (= D175), I176 (≠ P176), R179 (≠ N179), H204 (= H205), V205 (≠ C206), P206 (= P207), T211 (≠ N212), A232 (≠ T233), R234 (= R235), H295 (= H296), G297 (≠ A298), F298 (= F299)
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
31% identity, 80% coverage: 47:313/334 of query aligns to 47:308/334 of 5aovA
- active site: L100 (≠ S102), R241 (= R235), D265 (= D259), E270 (= E264), H288 (= H296)
- binding glyoxylic acid: M52 (≠ F52), L53 (≠ V53), L53 (≠ V53), Y74 (≠ R76), A75 (≠ C77), V76 (≠ A78), G77 (= G79), R241 (= R235), H288 (= H296)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (≠ A78), T104 (≠ V106), F158 (≠ T153), G159 (= G154), R160 (≠ E155), I161 (= I156), S180 (≠ D175), R181 (≠ P176), A211 (≠ H205), V212 (≠ C206), P213 (= P207), T218 (≠ N212), I239 (≠ T233), A240 (≠ S234), R241 (= R235), H288 (= H296), G290 (vs. gap)
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
35% identity, 81% coverage: 47:317/334 of query aligns to 43:303/304 of 1wwkA
- active site: S96 (= S102), R230 (= R235), D254 (= D259), E259 (= E264), H278 (= H296)
- binding nicotinamide-adenine-dinucleotide: V100 (= V106), G146 (= G152), F147 (≠ T153), G148 (= G154), R149 (≠ E155), I150 (= I156), Y168 (≠ F174), D169 (= D175), P170 (= P176), V201 (≠ C206), P202 (= P207), T207 (≠ N212), T228 (= T233), S229 (= S234), D254 (= D259), H278 (= H296), G280 (≠ A298)
7dkmA Phgdh covalently linked to oridonin (see paper)
31% identity, 76% coverage: 56:310/334 of query aligns to 54:293/306 of 7dkmA
- binding nicotinamide-adenine-dinucleotide: T74 (≠ A78), A102 (≠ V106), G148 (= G152), R151 (≠ E155), I152 (= I156), Y170 (≠ F174), D171 (= D175), P172 (= P176), I173 (≠ F177), H202 (= H205), T203 (≠ C206), P204 (= P207), T209 (≠ N212), C230 (≠ T233), A231 (≠ S234), R232 (= R235), H279 (= H296), G281 (≠ A298)
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: E293 (= E310)
Sites not aligning to the query:
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: 14, 17, 18
6cwaA Crystal structure phgdh in complex with nadh and 3-phosphoglycerate at 1.77 a resolution (see paper)
31% identity, 76% coverage: 56:310/334 of query aligns to 52:291/299 of 6cwaA
- binding 1,4-dihydronicotinamide adenine dinucleotide: N96 (≠ S102), A100 (≠ V106), R149 (≠ E155), I150 (= I156), Y168 (≠ F174), D169 (= D175), P170 (= P176), I171 (≠ F177), H200 (= H205), T201 (≠ C206), P202 (= P207), T207 (≠ N212), C228 (≠ T233), A229 (≠ S234), R230 (= R235), H277 (= H296), G279 (≠ A298)
6rj2A Crystal structure of phgdh in complex with compound 40 (see paper)
31% identity, 76% coverage: 56:310/334 of query aligns to 50:289/299 of 6rj2A
- binding ~{N}-[(1~{R})-1-[4-(ethanoylsulfamoyl)phenyl]ethyl]-2-methyl-5-phenyl-pyrazole-3-carboxamide: G146 (= G154), I148 (= I156), Y166 (≠ F174), D167 (= D175), P168 (= P176), I169 (≠ F177), I170 (≠ V178), H198 (= H205), T199 (≠ C206), L208 (= L215), R228 (= R235)
Query Sequence
>CA265_RS10420 FitnessBrowser__Pedo557:CA265_RS10420
MKIVFFSAKPYDHEFFESANKHYDFELEFWETHLGPHIADAIKAGTDVVCVFVNDKLTAE
VIATLAQKGVKIIALRCAGFNNVDLNAAKQHGIRVCRVPAYSPQAVAEHAVAMLLTLNRK
THKAYNRVREQNFSLSGLMGFNLFGKTVGVIGTGEIGTAFCKIMLGFGCRVMAFDPFVNA
SLASAGVEYLPFHEVIKEADMISLHCPLTPENHYLIGSNSLSTMKKGVTLINTSRGGLIN
TREVIEALKTGQLAALGIDVYEQEEQLFFKDLSGSIIGDDDIQRLISFPNVLLTGHQAFF
TQEALTEIAESTLKTVKILSENKAEEEVSDAILV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory