Comparing CA265_RS10520 FitnessBrowser__Pedo557:CA265_RS10520 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8j5qD Cryo-em structure of mycobacterium tuberculosis oppabcd in the pre- translocation state (see paper)
40% identity, 99% coverage: 1:565/568 of query aligns to 3:603/611 of 8j5qD
8j5tD Cryo-em structure of mycobacterium tuberculosis oppabcd in the catalytic intermediate state (see paper)
40% identity, 99% coverage: 1:565/568 of query aligns to 3:603/608 of 8j5tD
8j5sD Cryo-em structure of mycobacterium tuberculosis oppabcd in the pre- catalytic intermediate state (see paper)
40% identity, 99% coverage: 1:565/568 of query aligns to 3:603/608 of 8j5sD
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
37% identity, 45% coverage: 1:258/568 of query aligns to 3:263/330 of P0AAH4
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
36% identity, 45% coverage: 308:564/568 of query aligns to 1:239/241 of 4u00A
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
37% identity, 42% coverage: 325:563/568 of query aligns to 10:243/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
37% identity, 42% coverage: 325:563/568 of query aligns to 11:244/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
37% identity, 42% coverage: 325:563/568 of query aligns to 11:244/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
37% identity, 42% coverage: 325:563/568 of query aligns to 11:244/344 of 3tuiC
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
38% identity, 45% coverage: 20:272/568 of query aligns to 21:274/326 of Q8RDH4
Sites not aligning to the query:
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
39% identity, 41% coverage: 20:254/568 of query aligns to 20:254/310 of 4fwiB
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
39% identity, 40% coverage: 339:564/568 of query aligns to 20:239/240 of 4ymuJ
Sites not aligning to the query:
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
33% identity, 45% coverage: 307:564/568 of query aligns to 1:247/253 of 7z15I
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
33% identity, 45% coverage: 307:564/568 of query aligns to 1:247/250 of 7z18I
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
33% identity, 45% coverage: 307:564/568 of query aligns to 1:247/250 of 7z16I
3c4jA Abc protein artp in complex with atp-gamma-s
37% identity, 42% coverage: 328:564/568 of query aligns to 11:241/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
37% identity, 42% coverage: 328:564/568 of query aligns to 11:241/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
37% identity, 42% coverage: 328:564/568 of query aligns to 11:241/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
37% identity, 42% coverage: 328:564/568 of query aligns to 11:241/242 of 2oljA
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
38% identity, 42% coverage: 328:564/568 of query aligns to 25:251/378 of P69874
Sites not aligning to the query:
>CA265_RS10520 FitnessBrowser__Pedo557:CA265_RS10520
MLNVEHLNIDFYNQEEKTWFKAVKQISFKVKKGTVLGIVGESGSGKSVTSFSIMRLHDER
AAKITGEIDFEDISLLNLSSNEIRQIRGNQISMIFQEPMTSLNPVFTCGYQVAEAIMLHR
KVDQAEAKKHTIALFNEVQLPRPEKIFESYPHQISGGQKQRVMIAMALSCDPKLLIADEP
TTALDVTVQKTILQLLLKLKQERNMAMIFISHDLGVVNEIADEVAVMYKGEIVEQGPAKS
IFENPQHPYTKGLLACRPSPNRQLKKLPVVADFLTGEIEDASAHLQASNQLTTAEITARR
AKLYAQEPLLQIKNLCTWYPIHNGLFGKTTDYVKAVDQLNFEVFPGETLGLVGESGCGKT
TLGRTILRLIQPTSGEIIFNGENITHIGKTALRKLRKDIQIIFQDPYASLNPKLSIGQSI
LEPLQVHKLYRNDSERKQKVLELLDKVGLKEEHFNRYPHEFSGGQRQRVVIARALALQPK
FIICDESVSALDVSVQAQVLNLIKDLQSEFGLTYIFISHDLAVVKHISDRILVMNKGKIE
EEGFPEQIFYAPKAAYTQKLIEAIPGHQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory