SitesBLAST
Comparing CA265_RS10595 FitnessBrowser__Pedo557:CA265_RS10595 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
31% identity, 81% coverage: 88:458/458 of query aligns to 42:422/425 of O59010
- S65 (≠ T111) mutation to V: Strongly decreased chloride conductance.
- R276 (≠ A318) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (≠ ASS 318:320) binding
- M311 (≠ L353) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (≠ S356) binding
- V355 (= V397) binding
- D394 (= D430) binding
- M395 (= M431) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (= R433) mutation to A: Strongly decreased affinity for aspartate.
- N401 (= N437) binding
- D405 (≠ N441) mutation to N: Strongly decreased affinity for aspartate.
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
30% identity, 80% coverage: 88:455/458 of query aligns to 42:419/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: F46 (≠ L92), F46 (≠ L92), P75 (≠ D121), L91 (≠ A138), F95 (≠ M142), L130 (≠ V180), I133 (≠ F183), I159 (≠ L209), Y167 (vs. gap), K196 (= K238), G200 (≠ Y242), I207 (≠ L249), F210 (= F252), L250 (≠ G292), I262 (≠ V304), M269 (≠ A311), T334 (≠ G376), V335 (≠ F377), G336 (≠ E378), T340 (≠ S382), L343 (= L385), M399 (≠ A435)
- binding aspartic acid: S277 (= S319), S278 (= S320), T314 (≠ S356), G354 (= G396), A358 (= A400), G359 (≠ S401), D394 (= D430), R397 (= R433), T398 (≠ S434)
- binding sodium ion: Y89 (≠ F136), T92 (≠ M139), S93 (= S140), G306 (= G348), T308 (≠ S350), N310 (= N352), N310 (= N352), M311 (≠ L353), D312 (= D354), S349 (= S391), I350 (≠ K392), T352 (≠ I394), N401 (= N437), V402 (= V438), D405 (≠ N441)
Sites not aligning to the query:
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
31% identity, 80% coverage: 88:453/458 of query aligns to 34:409/409 of 6bavA
2nwwA Crystal structure of gltph in complex with tboa (see paper)
30% identity, 80% coverage: 88:452/458 of query aligns to 33:407/407 of 2nwwA
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
30% identity, 80% coverage: 88:452/458 of query aligns to 34:408/408 of 6bauA
- binding cysteine: S270 (= S320), M303 (≠ L353), T306 (≠ S356), A345 (= A395), G346 (= G396), V347 (= V397), G351 (≠ S401), D386 (= D430), C389 (≠ R433), T390 (≠ S434), N393 (= N437)
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
30% identity, 80% coverage: 88:452/458 of query aligns to 39:413/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: G66 (= G115), V83 (≠ L133), I157 (≠ F210), Y164 (vs. gap), K193 (= K238), T305 (≠ S350), I306 (≠ F351), I347 (≠ K392)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: M199 (= M244), S275 (= S320), T311 (≠ S356), G356 (≠ S401), L384 (≠ I423), D391 (= D430), R394 (= R433)
Sites not aligning to the query:
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
32% identity, 81% coverage: 88:458/458 of query aligns to 33:411/416 of 6r7rA
- binding d-aspartic acid: R263 (≠ A318), S265 (= S320), M299 (≠ L353), T302 (≠ S356), T340 (≠ I394), G342 (= G396), V343 (= V397), G347 (≠ S401), D383 (= D430), R386 (= R433), T387 (≠ S434), N390 (= N437)
- binding decyl-beta-d-maltopyranoside: V212 (≠ L267), A216 (= A271)
Sites not aligning to the query:
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
31% identity, 81% coverage: 88:458/458 of query aligns to 38:420/425 of 6zgbA
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
31% identity, 81% coverage: 88:458/458 of query aligns to 37:419/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L191 (≠ K238), G195 (≠ Y242), R282 (≠ M329)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (≠ A318), S272 (= S319), S273 (= S320), M307 (≠ L353), T310 (≠ S356), G353 (≠ R399), A354 (= A400), R394 (= R433), T395 (≠ S434)
Sites not aligning to the query:
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
31% identity, 81% coverage: 88:458/458 of query aligns to 40:422/426 of 6xwnB
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
31% identity, 81% coverage: 88:458/458 of query aligns to 40:422/427 of 5e9sA
- binding aspartic acid: R274 (≠ A318), S275 (= S319), S276 (= S320), T313 (≠ S356), G353 (= G396), V354 (= V397), A357 (= A400), G358 (≠ S401), D394 (= D430), R397 (= R433), T398 (≠ S434)
- binding decyl-beta-d-maltopyranoside: L194 (≠ K238), G198 (≠ Y242), Y202 (≠ F246)
- binding sodium ion: Y87 (≠ F136), T90 (≠ M139), S91 (= S140), S276 (= S320), G305 (= G348), A306 (≠ Y349), T307 (≠ S350), N309 (= N352), N309 (= N352), M310 (≠ L353), D311 (= D354), S348 (= S391), I349 (≠ K392), G350 (= G393), T351 (≠ I394), N401 (= N437), V402 (= V438), D405 (≠ N441)
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
28% identity, 80% coverage: 88:452/458 of query aligns to 34:396/396 of 6bmiA
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
29% identity, 83% coverage: 81:458/458 of query aligns to 45:411/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: S88 (≠ V125), G89 (= G126), G92 (= G129), A95 (≠ T132), V96 (≠ L133), Y99 (≠ F136), M163 (≠ L209), F167 (≠ V213), F293 (= F343), V297 (≠ L347)
- binding aspartic acid: S268 (= S319), S269 (= S320), T306 (≠ S356), G346 (= G396), I347 (≠ V397), A350 (= A400), G351 (≠ S401), D380 (= D430), R383 (= R433), T384 (≠ S434)
8cv2A Human excitatory amino acid transporter 3 (eaat3) in an outward facing sodium-bound state (see paper)
29% identity, 82% coverage: 76:450/458 of query aligns to 26:421/433 of 8cv2A
- binding sodium ion: Y85 (≠ F136), T88 (≠ M139), T89 (≠ S140), G319 (= G348), A320 (≠ Y349), N323 (= N352), N323 (= N352), M324 (≠ L353), D325 (= D354), N408 (= N437), D412 (≠ N441)
8cuaA Human excitatory amino acid transporter 3 (eaat3) with bound potassium in an intermediate outward facing state (see paper)
29% identity, 82% coverage: 76:450/458 of query aligns to 26:403/416 of 8cuaA
8ctcA Human excitatory amino acid transporter 3 (eaat3) with bound glutamate in an intermediate outward facing state (see paper)
29% identity, 82% coverage: 76:450/458 of query aligns to 23:400/406 of 8ctcA
- binding glutamic acid: S268 (= S319), S269 (= S320), M303 (≠ L353), T306 (≠ S356), G346 (= G396), A350 (= A400), D380 (= D430), R383 (= R433)
- binding sodium ion: Y82 (≠ F136), T85 (≠ M139), T86 (≠ S140), S269 (= S320), G298 (= G348), A299 (≠ Y349), T300 (≠ S350), N302 (= N352), N302 (= N352), M303 (≠ L353), D304 (= D354), S341 (= S391), I342 (≠ K392), G343 (= G393), A344 (≠ I394), N387 (= N437), D391 (≠ N441)
7nsgA Structure of human excitatory amino acid transporter 3 (eaat3) in complex with hip-b
29% identity, 82% coverage: 76:450/458 of query aligns to 30:418/430 of 7nsgA
- binding (+)-3-Hydroxy-4,5,6,6a-tetrahydro-3aH-pyrrolo[3,4-d]isoxazole-6-carboxylic acid: S287 (= S320), D398 (= D430), R401 (= R433), T402 (≠ S434), N405 (= N437)
- binding (-)-3-Hydroxy-4,5,6,6a-tetrahydro-3aH-pyrrolo[3,4-d]isoxazole-6-carboxylic acid: P366 (= P398), D398 (= D430), R401 (= R433), T402 (≠ S434)
- binding cholesterol hemisuccinate: I258 (≠ L291)
Sites not aligning to the query:
6s3qA Structure of human excitatory amino acid transporter 3 (eaat3) in complex with tfb-tboa
29% identity, 82% coverage: 76:450/458 of query aligns to 30:418/430 of 6s3qA
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: S286 (= S319), S287 (= S320), T324 (≠ S356), A358 (≠ T390), G361 (= G393), V365 (= V397), A368 (= A400), T372 (≠ V404), D398 (= D430), R401 (= R433), T402 (≠ S434), N405 (= N437)
- binding cholesterol hemisuccinate: K80 (≠ R127), R84 (≠ K131)
6x2zA Heaat3-ofs-asp (see paper)
28% identity, 82% coverage: 76:450/458 of query aligns to 24:408/419 of 6x2zA
- binding aspartic acid: S275 (≠ A318), S277 (= S320), T314 (≠ S356), G354 (= G396), V355 (= V397), D388 (= D430), R391 (= R433), T392 (≠ S434)
- binding sodium ion: Y83 (≠ F136), T86 (≠ M139), T87 (≠ S140), G306 (= G348), A307 (≠ Y349), T308 (≠ S350), I309 (≠ F351), N310 (= N352), N310 (= N352), M311 (≠ L353), M311 (≠ L353), D312 (= D354), S349 (= S391), I350 (≠ K392), G351 (= G393), A352 (≠ I394), N395 (= N437), D399 (≠ N441)
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
28% identity, 83% coverage: 81:458/458 of query aligns to 37:397/397 of 5mjuA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: L72 (≠ V116), S80 (≠ V125), G81 (= G126), G84 (= G129), Y91 (≠ F136), M156 (≠ L209), F160 (≠ V213), F286 (= F343), V290 (≠ L347)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I64 (≠ V108), I148 (= I201), S262 (= S320), S263 (≠ E321), A292 (≠ Y349), T293 (≠ S350), M296 (≠ L353), T299 (≠ S356), G329 (= G393), A336 (= A400), G337 (≠ S401), D366 (= D430), R369 (= R433), N373 (= N437)
Query Sequence
>CA265_RS10595 FitnessBrowser__Pedo557:CA265_RS10595
MKKNKLTLFIFLALIAGIALGYILNVNSINVYNQNILTADAKVKSIEVRIAKSTDTTSIG
YTQLKAERKANAKIKKENEDIREKKLEYFTLLSDIFLRLIKMIVAPLVFTTLVVGVAKVG
DIKAVGRIGGKTLGWFLAMSLMSLVLGMVLVNLFEPGRHMKLSLPDQLVNTGIQKAAMSV
KDFIAHVFPKSIAESMSTNEILQIVVFSLFFGVATAAIGDLGQIVIKAFDAIAHVILKMT
GYVMNFAPLAVFGAMTAIVAKQGLNVLNTYAIFIGEFYLGLAILWAVLIFLGFLVLKKRI
FRLVNDMKEPALLAFSTASSEAAYPKTMMLLERFGCKDKIVSFVLPLGYSFNLDGSMMYM
TFASLFIAQAYGIHLGFEQQISMLLILMLTSKGIAGVPRASLVVIAGTIASFNIPEAGLA
LLIGIDPLLDMGRSATNVVGNSIATAVVSKWEGELKES
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory