SitesBLAST
Comparing CA265_RS11300 FitnessBrowser__Pedo557:CA265_RS11300 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2qm1B Crystal structure of glucokinase from enterococcus faecalis
28% identity, 95% coverage: 7:303/313 of query aligns to 9:321/325 of 2qm1B
3vglA Crystal structure of a rok family glucokinase from streptomyces griseus in complex with glucose and amppnp (see paper)
30% identity, 93% coverage: 7:298/313 of query aligns to 4:306/312 of 3vglA
- binding phosphoaminophosphonic acid-adenylate ester: G9 (= G12), T11 (≠ S14), K12 (≠ S15), G130 (= G137), T131 (= T138), G180 (≠ V187), G214 (= G207), S218 (≠ V211), G260 (= G253), V261 (≠ I254), E264 (≠ S257)
- binding beta-D-glucopyranose: G65 (= G72), P78 (≠ D84), N103 (= N110), D104 (= D111), L133 (≠ I140), G134 (= G141), E153 (= E160), H156 (= H163), E175 (= E182)
- binding zinc ion: H156 (= H163), C166 (= C173), C168 (= C175), C173 (= C180)
3vgkB Crystal structure of a rok family glucokinase from streptomyces griseus (see paper)
30% identity, 93% coverage: 7:298/313 of query aligns to 4:306/312 of 3vgkB
5f7qE Rok repressor lmo0178 from listeria monocytogenes bound to operator (see paper)
27% identity, 83% coverage: 5:263/313 of query aligns to 83:348/396 of 5f7qE
Sites not aligning to the query:
- binding : 5, 8, 12, 15, 32, 43, 44, 67, 68, 68, 69, 69, 70, 70, 71, 72, 73
5f7rA Rok repressor lmo0178 from listeria monocytogenes bound to inducer (see paper)
27% identity, 83% coverage: 5:263/313 of query aligns to 2:264/306 of 5f7rA
- binding alpha-D-glucopyranose: K7 (≠ D10), E10 (≠ G13), G70 (= G72), N110 (≠ D111), N110 (≠ D111), S134 (≠ T135), V135 (= V136), G138 (= G139), L139 (≠ I140), G140 (= G141), E159 (= E160), H162 (= H163), E181 (= E182), E253 (≠ G252)
- binding zinc ion: H162 (= H163), C172 (= C173), C174 (= C175), C179 (= C180)
Sites not aligning to the query:
Q93LQ8 Beta-glucoside kinase; EC 2.7.1.85 from Klebsiella pneumoniae (see paper)
25% identity, 96% coverage: 9:309/313 of query aligns to 6:293/297 of Q93LQ8
- D7 (= D10) mutation to G: Loss of catalytic activity.
- G9 (= G12) mutation to A: Loss of catalytic activity.
- D103 (= D111) mutation to G: Loss of catalytic activity.
- G131 (= G139) mutation to A: Loss of catalytic activity.
- G133 (= G141) mutation to A: Loss of catalytic activity.
1z05A Crystal structure of the rok family transcriptional regulator, homolog of e.Coli mlc protein.
25% identity, 88% coverage: 25:298/313 of query aligns to 96:378/396 of 1z05A
4db3A 1.95 angstrom resolution crystal structure of n-acetyl-d-glucosamine kinase from vibrio vulnificus.
27% identity, 95% coverage: 3:298/313 of query aligns to 5:305/311 of 4db3A
3vovB Crystal structure of rok hexokinase from thermus thermophilus (see paper)
29% identity, 96% coverage: 7:306/313 of query aligns to 4:296/298 of 3vovB
6jdbA Crystal structure of n-acetyl mannosmaine kinase in complex with mannac-6p and adp from haemophilus influenzae
28% identity, 93% coverage: 7:298/313 of query aligns to 4:282/290 of 6jdbA
- binding adenosine-5'-diphosphate: K12 (≠ S15), S129 (≠ G137), T130 (= T138), P195 (≠ G207), K196 (= K208), S241 (vs. gap)
- binding 2-acetamido-2-deoxy-6-O-phosphono-alpha-D-mannopyranose: T62 (≠ P71), G63 (= G72), A72 (≠ G82), L73 (≠ A83), N74 (≠ D84), N77 (= N85), N102 (= N110), D103 (= D111), S129 (≠ G137), T130 (= T138), H152 (≠ E160), H155 (= H163), E174 (= E182)
- binding zinc ion: H155 (= H163), C165 (= C173), C167 (= C175), C172 (= C180)
7p9lAAA Ubiquitin-like protein SMT3,N-acetyl-D-glucosamine kinase
26% identity, 93% coverage: 8:298/313 of query aligns to 5:299/303 of 7p9lAAA
- binding 2-acetamido-2-deoxy-6-O-phosphono-beta-D-glucopyranose: P66 (= P71), G67 (= G72), S79 (≠ D84), N105 (= N110), D106 (= D111), G132 (= G137), T133 (= T138), G134 (= G139), V135 (≠ I140), G136 (= G141), E155 (= E160), H158 (= H163), D188 (≠ E182)
- binding zinc ion: H158 (= H163), C179 (= C173), C181 (= C175), C186 (= C180), E212 (= E203), H216 (≠ K213)
7p9pAAA Ubiquitin-like protein SMT3,N-acetyl-D-glucosamine kinase
26% identity, 93% coverage: 8:298/313 of query aligns to 6:300/304 of 7p9pAAA
- binding phosphoaminophosphonic acid-adenylate ester: G11 (= G13), T12 (≠ S14), K13 (≠ S15), G133 (= G137), T134 (= T138), G194 (vs. gap), E198 (≠ T188), A211 (≠ P201), G256 (= G252), G257 (= G253), N260 (≠ E256)
- binding zinc ion: H159 (= H163), C180 (= C173), C182 (= C175), C187 (= C180), E213 (= E203), H217 (≠ K213)
7p7wBBB Ubiquitin-like protein SMT3,N-acetyl-D-glucosamine kinase
26% identity, 93% coverage: 8:298/313 of query aligns to 8:302/306 of 7p7wBBB
1z6rA Crystal structure of mlc from escherichia coli (see paper)
27% identity, 77% coverage: 57:298/313 of query aligns to 117:364/382 of 1z6rA
P50456 DNA-binding transcriptional repressor Mlc; Making large colonies protein; Membrane linked control from Escherichia coli (strain K12) (see 4 papers)
26% identity, 77% coverage: 57:298/313 of query aligns to 141:388/406 of P50456
- H247 (= H163) binding
- C257 (= C173) binding ; mutation to A: Strongly reduced activity; when associated with A-259.; mutation to S: Strongly reduced activity; when associated with S-259.
- C259 (= C175) binding ; mutation to A: Strongly reduced activity; when associated with A-257.; mutation to S: Strongly reduced activity; when associated with S-257.
- C264 (= C180) binding
- R306 (≠ H228) mutation to G: Forms dimers but not tetramers; when associated with G-310.
- L310 (= L232) mutation to G: Forms dimers but not tetramers; when associated with G-306.
Sites not aligning to the query:
- 52 R→H: Shows increased expression and forms larger colonies.
- 86 H→R: Can be bound and inactivated by MtfA.
- 136 F→A: Decreases association with PtsG EIIB domain.
2yhwA High-resolution crystal structures of n-acetylmannosamine kinase: insights about substrate specificity, activity and inhibitor modelling. (see paper)
27% identity, 84% coverage: 6:268/313 of query aligns to 5:277/309 of 2yhwA
O35826 Bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase; UDP-GlcNAc-2-epimerase/ManAc kinase; EC 3.2.1.183; EC 2.7.1.60 from Rattus norvegicus (Rat) (see paper)
26% identity, 86% coverage: 1:268/313 of query aligns to 404:685/722 of O35826
- D413 (= D10) mutation D->K,N: No effect on UDP-N-acetylglucosamine 2-epimerase activity. Does not affect feedback inhibition by CMP-Neu5Ac. Loss of N-acylmannosamine kinase activity. Does not interfere with oligomerization.
- R420 (≠ K17) mutation to M: No effect on UDP-N-acetylglucosamine 2-epimerase activity. Does not affect feedback inhibition by CMP-Neu5Ac. Loss of N-acylmannosamine kinase activity. Does not interfere with oligomerization.
Sites not aligning to the query:
- 1 UDP-N-acetylglucosamine 2-epimerase
- 49 H→A: Loss UDP-N-acetylglucosamine 2-epimerase activity. No effect on N-acylmannosamine kinase activity. Does not interfere with enzyme oligomerization.
- 110 H→A: Loss UDP-N-acetylglucosamine 2-epimerase activity. No effect on N-acylmannosamine kinase activity. Partial reduction of the dimerization process.
- 132 H→A: Loss UDP-N-acetylglucosamine 2-epimerase activity. No effect on N-acylmannosamine kinase activity. Partial reduction of the dimerization process.
- 155 H→A: Loss UDP-N-acetylglucosamine 2-epimerase activity. No effect on N-acylmannosamine kinase activity. Strong reduction of the dimerization process.
- 157 H→A: Loss UDP-N-acetylglucosamine 2-epimerase activity. No effect on N-acylmannosamine kinase activity. Strong reduction of the dimerization process.
- 406:722 N-acetylmannosamine kinase
Q9Y223 Bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase; UDP-GlcNAc-2-epimerase/ManAc kinase; EC 3.2.1.183; EC 2.7.1.60 from Homo sapiens (Human) (see 18 papers)
26% identity, 86% coverage: 1:268/313 of query aligns to 404:685/722 of Q9Y223
- D413 (= D10) binding
- G416 (= G13) binding
- T417 (≠ S14) binding
- N418 (≠ S15) binding
- R420 (≠ K17) binding
- I472 (= I68) to T: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; corresponding to 50% of the wild-type activity; decreased N-acylmannosamine kinase activity; corresponding to less than 10% of wild-type activity
- G476 (= G72) binding ; binding
- R477 (≠ I73) binding ; binding
- T489 (≠ A83) binding ; binding
- N516 (= N110) binding ; binding
- D517 (= D111) active site; binding ; binding ; mutation D->A,N: Loss of N-acylmannosamine kinase activity. Decreased affinity for N-acyl-D-mannosamine. No effect on structure.
- N519 (= N113) to S: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; decreased N-acylmannosamine kinase activity; dbSNP:rs1554658910; mutation to S: Decreased N-acylmannosamine kinase activity.
- A524 (≠ G118) to V: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; corresponding to less than 10% of wild-type activity; decreased N-acylmannosamine kinase activity; impaired homohexamers formation; dbSNP:rs764698870
- F528 (≠ Y122) to C: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; retains 70% of wild-type activity; decreased N-acylmannosamine kinase activity; dbSNP:rs986773986; mutation to C: Decreased N-acylmannosamine kinase activity.
- G545 (= G139) binding
- E566 (= E160) binding
- H569 (= H163) binding ; binding ; binding
- V572 (= V166) to L: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; retains 70-80% of wild-type activity; decreased N-acylmannosamine kinase activity; corresponding to less than 10% of wild-type activity; does not affect homohexamers formation; dbSNP:rs121908632
- G576 (= G170) to E: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; decreased N-acylmannosamine kinase activity; dbSNP:rs121908625
- C579 (= C173) binding
- C581 (= C175) binding
- C586 (= C180) binding
- I587 (≠ L181) to T: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; decreased N-acylmannosamine kinase activity; dbSNP:rs748949603; mutation to T: Decreased N-acylmannosamine kinase activity.
- E588 (= E182) binding ; binding
- A630 (≠ K213) to T: in NM; decreased N-acylmannosamine kinase activity; does not affect homohexamers formation; dbSNP:rs1382191649
- A631 (≠ Y214) to T: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; retains 80% of wild-type activity; decreased N-acylmannosamine kinase activity; retains 75% of wild-type activity; dbSNP:rs121908626; to V: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; retains 70% of wild-type activity; decreased N-acylmannosamine kinase activity; does not affect homohexamers formation; dbSNP:rs62541771; mutation A->V,T: Decreased N-acylmannosamine kinase activity.
Sites not aligning to the query:
- 13 C → S: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; corresponding to 20% of wild-type activity; no effect on N-acylmannosamine kinase activity; dbSNP:rs1209266607
- 19 binding
- 23 binding
- 113 binding
- 132 H → Q: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; corresponding to less than 10% of wild-type activity; impaired homohexamers formation
- 176 D → V: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; corresponding to 20% of wild-type activity; no effect on N-acylmannosamine kinase activity; impaired homohexamers formation; dbSNP:rs139425890
- 177 R → C: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; corresponding to less than 20% of wild-type activity; no effect on N-acylmannosamine kinase activity; impaired homohexamers formation; dbSNP:rs539332585
- 200 I → F: in NM; uncertain significance; decreased UDP-N-acetylglucosamine 2-epimerase activity; retains 90% of wild-type activity; decreased N-acylmannosamine kinase activity; retains 75% of wild-type activity; dbSNP:rs369328625
- 206 G → S: in NM; moderate phenotype with unusual involvement of quadriceps; dbSNP:rs766266918
- 220 binding
- 253 binding
- 259 binding
- 263 R → L: in SIALURIA; strong reduction of feedback inhibition by CMP-Neu5Ac; dbSNP:rs121908623
- 266 R → Q: in SIALURIA; abolishes feedback inhibition by CMP-Neu5Ac; dbSNP:rs121908622; R → W: in sialuria; dbSNP:rs121908621
- 271 binding
- 280 binding
- 281 binding
- 282 binding
- 301 binding
- 302 binding
- 303 C → V: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; retains 80% of wild-type activity; decreased N-acylmannosamine kinase activity; corresponding to 60% of wild-type activity; requires 2 nucleotide substitutions; dbSNP:rs121908633
- 307 binding
- 321 binding
- 331 V → A: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; corresponding to 20% of wild-type activity; no effect on N-acylmannosamine kinase activity; impaired homohexamers formation
- 378 D → Y: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; corresponding to 10-30% of wild-type activity; decreased N-acylmannosamine kinase activity; impaired homohexamers formation; dbSNP:rs199877522
- 708 G → S: in NM; decreased UDP-N-acetylglucosamine 2-epimerase activity; decreased N-acylmannosamine kinase activity; severely decreased; dbSNP:rs1554657922
- 712 M→T: Decreased N-acylmannosamine kinase activity.
2yi1A Crystal structure of n-acetylmannosamine kinase in complex with n- acetyl mannosamine 6-phosphate and adp. (see paper)
26% identity, 84% coverage: 6:268/313 of query aligns to 5:276/308 of 2yi1A
- binding adenosine-5'-diphosphate: G11 (= G12), T13 (≠ S14), N14 (≠ S15), R16 (≠ K17), T140 (= T138), G189 (≠ V187), L216 (vs. gap), V261 (≠ G253)
- binding 2-acetamido-2-deoxy-6-O-phosphono-alpha-D-mannopyranose: G12 (= G13), G71 (≠ P71), G72 (= G72), R73 (≠ I73), S84 (≠ G82), T85 (≠ A83), L87 (≠ N85), N112 (= N110), D113 (= D111), G139 (= G137), T140 (= T138), G141 (= G139), I142 (= I140), E162 (= E160), H165 (= H163), E184 (= E182)
- binding calcium ion: N112 (= N110), N115 (= N113), G144 (= G142), A161 (≠ T159)
- binding zinc ion: H165 (= H163), C175 (= C173), C177 (= C175), C182 (= C180)
2yhyA Structure of n-acetylmannosamine kinase in complex with n- acetylmannosamine and adp (see paper)
26% identity, 84% coverage: 6:268/313 of query aligns to 5:276/308 of 2yhyA
- binding adenosine-5'-diphosphate: G11 (= G12), G12 (= G13), T13 (≠ S14), N14 (≠ S15), R16 (≠ K17), T140 (= T138), G189 (≠ V187), L216 (vs. gap), V261 (≠ G253)
- binding calcium ion: N112 (= N110), N115 (= N113), G144 (= G142), A161 (≠ T159)
- binding zinc ion: H165 (= H163), C175 (= C173), C177 (= C175), C182 (= C180)
Query Sequence
>CA265_RS11300 FitnessBrowser__Pedo557:CA265_RS11300
MEQSYAIGIDVGGSSLKCGVVNQNGEILYSIIVSLKNAKTQGAIIALIVEAIHTCAKKFK
NPILGVGIGFPGIIYNNKIIAGADNLPGFKQLALGEILQEVTRYNIVMDNDANLMGLGEM
TYGAAKDCSDVVFLTVGTGIGGAVMIDNKLYGGFRNRGTELGHIVVQHNGLACACGGRGC
LEAYASVTALLNHYQSIHPNPPEEIDGKYMVEKYLAREEYAVEAMESHFDYLATGIISFV
NVFSPQKIVIGGGISESGAFYVREIERRIKTLAVPIAPGNELVVAARLGNKAGLLGCAAN
VFQKFKAFDYVVK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory